KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0925Help
Entry
Lacal_0925        CDS       T01533                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00240  Pyrimidine metabolism
lan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Lacal_0925
Enzymes [BR:lan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Lacal_0925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AEH00773
UniProt: F6GFK9
LinkDB All DBs
Position
complement(1078757..1079404)
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNQKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAIDVRYDDEM
VVSHDSNEIRSTPVPAAANIPILADGCDVVGIDEAQFFDDEIVRVCNDLANKGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQFSYRKNKSEDLVLLGETEEYEP
LSRAAYYKATLREKIKTLKVNDAEELKENQDKPNA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcaaaaagaacaatttggttggattgaagttatatgt
ggatctatgttctctggtaaaaccgaagaattaattcgcagacttaaacgtgcccaattt
gcaaagcaaaaagttgaaatttttaaaccagcaatagatgtaagatatgatgatgaaatg
gtggtttctcatgactctaacgaaatacgctcaactccagttcctgcagctgcaaatatt
ccaattttagccgatggttgtgatgtagtaggtatagacgaagctcagttttttgatgac
gagattgtacgtgtttgtaacgatcttgcaaataaaggcatacgagtaattgttgcaggt
ttagatatggattttaaaggcaacccatttggaccaatgcctaacctaatggcaacagca
gagtatgtaacaaaagtacatgctgtttgtacacgtacaggaaaccttgcgcaatttagt
tatagaaaaaataaaagcgaagaccttgttttacttggtgaaacagaagaatacgaacct
ttaagtcgtgcagcttattataaagctacattaagagaaaaaataaaaacattgaaggtg
aatgatgcagaagaacttaaagaaaatcaagataaacctaatgcctaa

DBGET integrated database retrieval system