KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1550Help
Entry
Lacal_1550        CDS       T01533                                 

Definition
(GenBank) hypothetical protein
Organism
lan  Lacinutrix sp. 5H-3-7-4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_8 LRR_4
Motif
Other DBs
NCBI-ProteinID: AEH01398
UniProt: F6GK47
LinkDB All DBs
Position
1764542..1765360
Genome map
AA seq 272 aa AA seqDB search
MKTLNLTLICLFASLLSFANISQTEKNALLALHASTNGEQWTKKWDLNTDVSNWFGVTVE
NNKVVALNLPFNNLKGNLPEELGNLRALTKINFGFNKISGTIPSSFSKLNNLKSLELFLN
KLEGEIPSFLGTLTNLEVLALYSNSFSGDIPLELANLKNLKELQLGSNFLTGVIPSELGA
LTKLEKLSLIDNKLKGEIPLELTDLKNLEELILSENKLTGNLPLQFSQLNSLSTLMVSDN
NMDVEYATVVEDRASVRSSIVTYNDTYVVERD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcttaatcttacattaatctgcttatttgcatctttactaagttttgcaaat
atttctcaaacagaaaaaaatgcattattagcacttcatgcttcaacaaatggagagcaa
tggactaaaaaatgggatttaaacacagatgtttcaaattggtttggagtaactgtagaa
aataataaagttgtagcgcttaatcttccgtttaataatcttaaaggtaatttaccagaa
gaattaggaaacttaagagcattaactaaaattaactttggatttaataaaatatcagga
acaattccatcaagtttttctaaattaaataatttaaaatctttagagttatttttaaat
aaattagaaggtgagattccttcatttttaggaacattaactaatttagaagttttagca
ctgtatagtaatagtttttcaggagatatacctttggagttagcaaaccttaaaaactta
aaagaattacaattaggaagtaattttttaacaggagttataccatcagaattaggtgca
ttaaccaagcttgaaaaattaagcttaatagataataaattaaaaggtgaaataccatta
gaattaacagacttaaaaaatttagaagaattaattctttctgaaaataagttaacaggt
aatttaccattacaatttagccaattaaacagtcttagtacattaatggtaagtgacaat
aatatggatgtagaatatgcaactgtagtagaagatagagcaagtgttagaagttctata
gttacttataatgatacttatgttgtagaaagagattaa

DBGET integrated database retrieval system