KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109325828Help
Entry
109325828         CDS       T04664                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00040  Pentose and glucuronate interconversions
lang00051  Fructose and mannose metabolism
lang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109325828
   00051 Fructose and mannose metabolism
    109325828
Enzymes [BR:lang01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109325828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 NCD3G AlaDh_PNT_C Sacchrp_dh_NADP UDPG_MGDP_dh_N PALP Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 109325828
NCBI-ProteinID: XP_019413950
LinkDB All DBs
Position
LG13
AA seq 364 aa AA seqDB search
MGKGGMSIVDHGDGEEQNMAAWLVAINTLKIQPFNLPSIGPHDVRVRVKAVGICGSDVHY
LKTLRCADFIVKEPMVIGHECAGIIVEVGSQVTSLEPGDRVAIEPGISCWRCDPCKQGRY
NLCPDMKFFATPPVHGSLANQIVHPADLCFKLPQNVSLEEGAMCEPLSVGVHACRRANIG
PETNVLIMGAGPIGLVTLLAARAFGAPRIVIVDVDDHRLSVAKNLGADDIVKVSTNIEDV
ADEVIQIHKAMGAGIDVTLDCAGFNKTMSTALNATQAGGKVCLVGMGHSIMTVPLTPAAA
REVDVIGIFRYKNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEEAFETSARGGNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggaggaatgtcaattgttgatcatggagatggtgaagaacagaacatggct
gcttggcttgttgctattaacactctcaagattcaaccttttaatcttccttctattgga
ccccatgatgtcagagttagagtaaaagctgttggtatatgtgggagtgatgttcactac
ctcaagacactgagatgtgcagactttatagttaaagagccaatggttattggacatgag
tgtgctgggatcatagtagaagttggcagtcaggtaacgagtttggagcctggtgaccgt
gtggcaattgagcccgggatcagttgttggcgttgtgatccctgcaaacaaggtcggtat
aatctatgccctgatatgaagttttttgctactccaccggttcatggttctcttgcgaat
cagatagtgcatccagcagatctttgttttaaactaccacagaatgtgagcttggaggaa
ggggcaatgtgtgaacccttaagcgttggcgttcatgcttgtaggcgagcaaatattgga
cctgagacaaatgtattgatcatgggtgcaggacccataggacttgttacactgcttgca
gctcgcgcttttggagcacctaggattgtcattgtggatgtagatgaccatcgtttatct
gttgctaagaatctcggtgccgatgatattgttaaagtttcaacaaacattgaggatgtt
gctgatgaagttatacagatacacaaggctatgggagctggtattgatgttactcttgat
tgtgccggttttaacaaaaccatgtcaacagcactgaatgctactcaggcaggtggcaaa
gtttgcctagtgggaatgggccattctataatgacagtcccactcaccccagctgctgca
agggaagttgatgtgattggcattttccgctataagaacacatggcctctttgccttgag
tttctgaggagtggcaaaatcgatgtaaaaccccttataactcacaggtttgggttctct
caaaaggaagtggaagaagccttcgaaacaagtgctcgcgggggtaatgccattaaagtc
atgttcaatctttag

DBGET integrated database retrieval system