KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109325981Help
Entry
109325981         CDS       T04664                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:lang00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109325981
Enzymes [BR:lang01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109325981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 109325981
NCBI-ProteinID: XP_019414177
LinkDB All DBs
Position
LG13
AA seq 208 aa AA seqDB search
MQPALAAMASHTVLSPFPNPFLNSSFSSLSLKLSPQSLTLSPTTSSSKPLTVAAAAKKAV
AVLKGSSTVEGVVTLTQEDDGPTTVNVRVSGLTPGLHGFHLHEYGDTTNGCISTGPHFNP
DKLTHGAPEDEVRHAGDLGNIVANADGVAEATIVDNQVPLTGPNSVVGRALVVHELEDDL
GKGGHELSLTTGNAGGRLACGVVGLTPV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagcattagcagccatggcatcccacactgttctatcacctttccctaaccca
tttctcaattcatctttctcctctctctccctcaagctctctccccaatccctaacccta
tcacctaccacctcctcctccaagcccctcaccgtcgccgccgccgccaagaaagccgtc
gccgtcctcaagggaagctccaccgtcgaaggcgttgtcaccctcacccaagaagatgat
ggcccaacaaccgttaatgtccgtgtttctggtcttaccccagggcttcatggttttcac
ttgcatgagtatggtgataccaccaatggctgcatatcaacaggacctcattttaatcct
gataagctaacacatggtgctcctgaggatgaagtccgtcatgcgggtgacctgggaaac
atagttgctaatgcagatggggttgcagaggcaacaattgtggataaccaggtaccactc
actggccccaattctgtagttggaagagccttagtggttcatgagcttgaggatgacctt
ggaaagggtggccatgaacttagtttgaccactggaaatgctggtggaagattagcatgt
ggtgtggttggtttgactccagtataa

DBGET integrated database retrieval system