KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109326620Help
Entry
109326620         CDS       T04664                                 

Definition
(RefSeq) SWI/SNF complex subunit SWI3C-like
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Brite
KEGG Orthology (KO) [BR:lang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lang03021]
    109326620
   03036 Chromosome and associated proteins [BR:lang03036]
    109326620
Transcription machinery [BR:lang03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     109326620
Chromosome and associated proteins [BR:lang03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    109326620
   PBAF complex
    109326620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_1 SWIRM Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 109326620
NCBI-ProteinID: XP_019414880
UniProt: A0A4P1QZN0
LinkDB All DBs
Position
LG14
AA seq 788 aa AA seqDB search
MSPSPSENRSRWRKRKRESQIGRRQQKHHHHHEDNDDDEEENRNATADEDHDDDSEDQFH
HPNPQSATNPQSHHEMEVLSDHAVQISQFPVVVKRSVNRPHSSVAAIIALERAIEFGDNN
HRQLRNAPVLENVSHGQLQALSTVPADSAALDQERGGDGSNSSFVITTPAILEGRGIVKR
FGNRVLVVPMHSDWFSPVSVHRLERQAVPHFFSGKSPDHTPEKYMECRNYIVALYMEDPE
KRITVSGCQGLLVGVDNEDLTRICRFLDHWGIINYCSRVPCHETWNDMSCLMEDTNGEVR
LPSDTLKSIDSLIKFDKPKCKLRADEIYSSLTTQNPDVSDLDDKIREHLSENHCNYCSRP
LPVVYYQSQKEVDILLCTDCFHDGRFVIGHSSLDFIRVDSTRDYSELDGDSWSDQETLLL
LEAVEIYNENWNEIAEHVGTKSKAQCILQFLRLPMEDGKLENINVPSMSSSNVTNRDDSG
RLHRCLNGDSEGPFHQSSNSGSRLPFANSGNPVMALVAFLASAVGPRVAASCAHAALGVL
SVDNSGSTTQMEAPVHGNRANLESTHSKDGGPRGEMAILTDHNEDKFGTIPLPLEKVKEA
AKAGLSAAATKAKLFADHEQREIQRLCANIVNHQLKRLELKLKQFAEIETLLMKECEQVE
RTRQRFAAERSHVISARRGTGGATPPMNTSGVGPSMVNSNGNIRQQMISASPSQPSISGY
GNNQQVHPHMSFGPRPSMFGLGQRLPLSMIQQSQSASSNALFNAPSNVQPTSNHPLLRPV
SGTNSGLG
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccttctccttcagaaaaccgaagcaggtggaggaagcgcaagagagaatcgcaa
atcggccggcggcaacagaagcaccaccaccaccacgaagacaatgacgatgacgaagag
gagaatcgcaatgccaccgccgatgaggaccatgatgacgactctgaggaccaatttcac
caccctaaccctcaatccgctaccaatccccaatcacaccatgagatggaggtcctctcc
gatcacgccgtccagatttcgcaattccctgtcgttgtcaagcgctctgtcaaccgccct
cactcctccgttgccgcaatcattgctctggagcgagctatcgagttcggggacaacaat
caccgtcagctcaggaatgctccggtgcttgagaatgtgtcccatggtcagcttcaggcg
ctgtctactgttcccgctgatagtgccgccttggatcaggagcgtggtggtgatggcagt
aattcgagctttgtcattactacgccagcgattttggaaggccgtggcattgtgaaacgc
tttgggaatagggtgcttgtagttcccatgcattcagattggttttcaccagtgtcagtg
catcgactagagagacaagcagtgccacatttcttttctggaaaatcaccagatcatact
ccagagaagtacatggagtgtaggaactacattgttgcactatacatggaggacccagag
aaaaggattacggtctcgggttgccagggattgttagttggggttgataatgaagattta
acaagaatttgcaggttccttgatcattggggaattatcaattactgttctcgggtgcct
tgtcatgagacttggaatgatatgtcctgcctgatggaggacacaaatggagaggtccgt
ttgccatcagatactttaaaatccattgatagtttgatcaaatttgacaagcctaagtgt
aagctcagagcagacgaaatttattcatcactgacaactcagaatcctgatgtctctgac
ctcgatgacaaaataagagagcacctatctgaaaatcattgcaattattgttctcgtcct
cttcctgttgtatactaccagtcacaaaaagaggttgatattttactctgcactgattgc
tttcatgatgggagatttgtcattggtcattcaagtcttgattttataagggtggattca
acaagggattatagtgagctagatggggatagttggagtgatcaagaaactttgctgctg
cttgaagcagtggagatttacaatgagaattggaatgaaattgctgagcatgttggtacc
aagtcaaaagcacaatgcattcttcaatttctccgtctacccatggaagatggaaaattg
gaaaatatcaatgttccaagcatgtcttcatctaatgtgacgaatagagatgatagtgga
agattgcatcgttgcttaaatggggattccgaaggacctttccatcaaagcagcaactct
ggcagcaggcttccctttgcaaattctggaaatcctgttatggctctggttgcgttttta
gcctctgcggttggaccaagagtagctgcttcttgtgcgcatgcagcattaggagtattg
tccgtggataattctgggagcacaacgcagatggaagcaccggtacatggtaatagggca
aatttggaaagcacacatagtaaagatggtggccctcgcggagaaatggcaattttaact
gatcataatgaggataagtttgggacaataccgcttcctttggagaaagttaaagaggca
gctaaagccggcctctctgctgcagcaacaaaagccaaattgttcgctgatcatgaacaa
cgagaaattcagaggctgtgtgctaatatcgttaatcatcagttgaaaagattggaattg
aagctgaagcagtttgcagaaattgaaacattgttgatgaaagaatgtgaacaagtcgag
aggacgaggcagaggtttgctgcggaacggtcccatgttatatcagcacgtcgtggaact
gggggagccacacctccgatgaatacatcaggtgttggtccttccatggttaacagtaat
ggcaacatccgacaacaaatgatctctgcctctccctcacaaccgagcatctcagggtat
ggcaacaaccaacaagttcatcctcacatgtcctttggtccacgaccttcaatgtttggg
ttggggcaaaggttgcccctatctatgatacagcaatcacaatcagcttcttcaaatgca
ctgttcaatgcccctagtaatgtgcagcccacttcaaatcatccattgttgaggcctgtg
tcagggactaactctggtttaggttaa

DBGET integrated database retrieval system