KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109329462Help
Entry
109329462         CDS       T04664                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00052  Galactose metabolism
lang00500  Starch and sucrose metabolism
lang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109329462
   00500 Starch and sucrose metabolism
    109329462
Enzymes [BR:lang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109329462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109329462
NCBI-ProteinID: XP_019418686
LinkDB All DBs
Position
LG16
AA seq 889 aa AA seqDB search
MTVPLFLCICFGLICSYVVADDGNSAAGFGYTISTLNNASSGQSLTANLNLINSSSVYGN
DIKNLNLTASFETKDRLRIRITDSNNKRWEIPEEVLPRGPSDSSNKTKQGFNNNLIQQEH
SLTIENSDLIFTLHNTTPFGFTVTRKSSNDVLFNSSSNSSNPASVLVFKDQYLQLSSQLP
KDRSSLYGLGEHTKSSFKLQPDYQKALTLWNADIGSLNVDQNLYGSHPFYMDVRSGSKDG
KVKSGTTHGVLLLNSNGMDIFYGGDIITYKVIGGVIDLYFFAGSTPELVLEQYTELIGRP
APMPYWSFGFHQSRYGYKNVSDLEGVVSNYSKTGIPLEVLWTDIDYMDAYKDFTLDPVNF
PQDKMKKLVDNLHNNSQKYVPILDPGIAINETYGTYERGLKADIYIKRNGTNYKGKVWPG
DVYFPDFLNPNGQAFWGDEIKLFRDQLAFDGIWLDMNEASNFITSGPLQNSSLDDPPYKI
KNSQINNNAIPATSLHYGNVTEYNVHNLYGFLQTKVTHKALTNITGKRPFILSRSTFVSS
GKYAAHWTGDNAASWNDLAYSIPSILNSGIFGIPMVGADICGFLRDTNEELCRRWIQLGA
FYPFSRDHSDKNSRRQELYLWDSVAASAKKVLALRYRLLPYFYTLNYEAHVKGTPIARPL
FFSFPEDVATYGINSQFLLGKGVLVSPVLKSGETKVEAYFPAGNWFELFNLSKSVTVKSG
KKVTLDAPSDHINVHVGEGNILALQGEAKTTEAARKTAFELLVVASSNGTSSGQVFLDDG
ETLDFAGGNEDWTLVKFNATLVNNSISVASNVTNGKYSLNQKWTINKVTILGIPKGKIST
NKKNGTLTNSKGKSDVKAQFNSSSEFVTVEVTELSQLIGEEFKLEIETK
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgacagtacctttgttcttatgcatatgttttggtctcatctgttcatatgttgtagca
gatgatggaaattcagctgctggttttggttacacaatctcaactctcaacaatgcttcc
tcaggacaatctttgactgctaaccttaatctcatcaactcatcctctgtctatggaaat
gacatcaaaaaccttaaccttactgccagttttgagaccaaggacaggttaaggataaga
atcactgattctaacaacaaaagatgggaaatcccagaagaagtgcttcctagaggcccc
tctgattcctccaacaagaccaagcaaggtttcaacaacaatctcattcagcaagaacac
tctctcaccattgagaactcagaccttatcttcacccttcacaacactaccccttttggc
tttactgtcactagaaaatcctccaatgatgtcctcttcaactcttcttcaaactcttca
aaccctgcatcagttcttgtcttcaaagaccagtacttgcaactctcttcccaactccct
aaagataggtcctcactttatggccttggggagcataccaagagctcattcaagctgcaa
ccagattaccaaaaagccttgactttgtggaatgcagatattggtagtttgaacgttgat
cagaacctttatggttctcatccattttatatggatgtgagatcaggttcaaaagatgga
aaagtgaagagtggaaccacacatggggtgttgctgctaaatagcaatggaatggacatt
ttctatggtggtgatattataacttataaggttattggtggagttattgatctgtatttt
tttgctggatccactcctgaattggtgttggaacagtacactgaactcattggaaggcct
gctcctatgccttattggtcctttggttttcatcagagtcgatatggctacaagaatgta
agtgatcttgagggtgtggtttcaaattattcaaaaacaggcataccccttgaagttcta
tggacagatattgattatatggacgcttacaaagatttcacacttgatcctgtcaacttt
ccacaggataagatgaaaaaacttgttgacaatctacacaacaatagtcagaaatatgtg
ccaatcttagaccctggtattgctataaatgagacatatggaacctatgagagaggtttg
aaggctgatatctacataaagagaaatggaaccaattataagggtaaagtttggcctgga
gatgtttacttccctgattttctaaatccaaatggccaagcattttggggtgatgaaatc
aaattatttcgggaccaactcgcattcgatggcatttggcttgacatgaatgaagcatct
aatttcatcacctctggtccccttcaaaattcaagtctcgatgaccctccctacaaaata
aaaaattcgcaaattaataacaacgcaatcccagcaacatctttgcattatggtaatgtc
actgagtataatgtccacaatttgtatggattcctacaaaccaaagtaactcacaaggct
ctaactaatataactggtaaaaggccattcattctcagtagatcaacttttgtaagctct
ggtaaatatgcagcacactggacaggagataatgctgcttcatggaatgatttggcatac
tctataccatcaatattaaattctggaatctttggaattccaatggttggggcagatata
tgtggtttcttaagagatactaatgaagaactttgcaggcgctggatccagttgggagct
ttttaccccttttcaagagatcattctgataaaaattcaaggaggcaagagctttacctt
tgggactcagttgctgcatcagctaagaaagtacttgccctccgatatcgactgctccct
tatttctatacactaaattacgaagcacatgttaaaggaacacctattgcacgacccctt
ttcttttcgttccccgaggatgtcgcaacatatggaataaattcacagtttctactaggc
aaaggggttctagtgtcacctgtactaaaatccggggaaaccaaagtcgaagcatacttt
cctgcaggaaactggtttgaacttttcaatctctcgaaatctgtgactgtgaaatcaggc
aagaaagttactcttgatgcaccatctgaccacataaatgtgcatgtcggggaaggtaat
attttggccttgcaaggagaagcaaaaacaaccgaagccgcgaggaagactgcatttgaa
ctcttggttgttgctagtagcaatggaactagttctggacaagtcttcttagatgatgga
gagacacttgactttgcaggagggaatgaagattggacattggtaaaatttaatgccaca
ttagtgaacaatagtatttctgttgcatctaatgtcactaatggaaaatattctctaaac
caaaagtggaccataaacaaggtaactatcttagggatacctaagggtaagatatcaact
aataagaagaacgggacactgacaaactcaaaagggaagagtgatgtgaaggcacagttc
aatagctcctctgagtttgttactgtagaagttacagaattgtcacagcttattggagag
gaatttaagctggaaattgaaaccaagtag

DBGET integrated database retrieval system