KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109329464Help
Entry
109329464         CDS       T04664                                 

Definition
(RefSeq) berberine bridge enzyme-like 21
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00052  Galactose metabolism
lang00500  Starch and sucrose metabolism
lang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109329464
   00500 Starch and sucrose metabolism
    109329464
Enzymes [BR:lang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109329464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 FAD_binding_4 BBE NtCtMGAM_N Gal_mutarotas_2 Sterile
Motif
Other DBs
NCBI-GeneID: 109329464
NCBI-ProteinID: XP_019418689
LinkDB All DBs
Position
LG16
AA seq 820 aa AA seqDB search
MIKGSCVSKEVLPRGPSDSSNKTKQGFNNNLIQQEHSLTIENSDLIFTLYNTTPFGFTVT
RKSSNDVLFNSSSNPASVLVFKDQYLQLSSHLPKNSSSIYGLGEHTKSTFKLQPDYQKPL
TLWNAYVPSTNVDQNLYGSHPFYMDVRSGSKDGKVKSGTTHGVLLLNSNGMDIFYGGDII
TYKVIGGVIDLYFFAGSTPELVLEQYTELIGRPAPMPYWSFGFHQSRYGYKNVSDLEGVV
SNYSKTGIPLEVLWTDIDYMDAYKDFTLDPVNFPQDKMKKLVDNLHNNSQKYVPILDPGI
AINETYGTYVRGLKADIYIKRNGTNYKSSTQLNNIVFSQTNPSFSTVLQNYIRNARFNTT
STSKPLIIVTPLQESHVQGTVICAKSIGIQIKIRSGGHDYEGISYISDEPFIILDLFNIR
KVYVDIEKETAMIQAGATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHISGGGYGNMLRK
YGLSVDNVIDAQIVDVKGRLLDRKSMGEDLFWAIKGGGGASFGVVLSYTVKLVSVPKIVT
IFRVMKTLEENATDLVVQWQKVAPNTDDRLFMRLLLQPVTSKKVKKSKTVRASVVALFLG
GVDEVVSILRNEFPLLGLKKEDCNETSWIGSVIWWNDDDAFNNGAKPETLLDRNLNSASF
GKRKSDYVQKAISKHDLESIWKKMIEQGKVGFVFNPYGGKMAEIASDATPFPHRAGNLFK
IQYSVNWDDPSEAAAQNFTNQAKNLHSFMTPFVSSNPRSAYINYRDIDIGINHFDKNSFE
EGKVYGTIYFNNNFDRLVKIKNAVDPENFFRNEQSIPVHA
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaggatcatgtgtctcaaaagaagtgcttcctagaggcccctctgattcctct
aacaaaaccaagcaaggtttcaacaacaatctcattcagcaagaacactcactcaccatt
gaaaactcagaccttatctttaccctttacaacactaccccttttggctttactgtcact
agaaaatcctccaatgatgtcctcttcaactcttcttcaaaccctgcatcagttcttgtc
ttcaaagaccagtacttgcaactctcttcccaccttcctaaaaatagctcctcaatatat
ggccttggggaacataccaagagcacattcaagctgcaaccagattaccaaaaacctttg
actttgtggaatgcatatgttcctagtaccaatgttgaccagaacctttatggttctcat
ccattttatatggatgtgagatcaggttcaaaagatggaaaagtgaagagtggaaccaca
catggggtgttgctgctaaatagcaatggaatggacattttctatggtggtgatattata
acttataaggttattggtggagttattgatctgtatttttttgctggatccactcctgaa
ttggtgttggaacagtacactgaactcattggaaggcctgctcctatgccttattggtcc
tttggttttcatcagagtcgatatggctacaagaatgtaagtgatcttgagggtgtggtt
tcaaattattcaaaaacaggcataccccttgaagttctatggacagatattgattatatg
gacgcttacaaagatttcacacttgatcctgtcaactttccacaggataagatgaaaaaa
cttgttgacaatctacacaataatagtcagaaatatgtgccaatcttagaccctggtatt
gctataaatgagacatatggaacctatgttagaggtttgaaggctgatatctacataaag
agaaatggaaccaattataagtcatcaacacaactcaacaacatagtcttttctcaaacc
aacccttctttctcaaccgttctccaaaactacatcagaaacgcacgtttcaacactact
tcaacatcaaaaccattaatcattgtcacaccccttcaagaatctcatgtccaaggcact
gttatctgtgccaaaagcattgggatccaaatcaagataaggagtggtggccatgattat
gagggtatttcctatatctctgatgaaccctttattatacttgaccttttcaacattaga
aaagtgtatgttgatatagaaaaagaaactgctatgatccaagctggtgcaacacttggt
gaagtttattataggatttgggagaagagtaaagttcatggctttcctgcaggggtgtgt
cctacagtaggggtaggtggtcatataagtggaggagggtatggtaatatgttaagaaaa
tatggtctttctgttgataatgttattgatgctcaaattgttgatgttaaaggtagactt
cttgatagaaaatctatgggggaggatttgttttgggctattaaaggaggtggaggagca
agttttggtgttgtattatcttatactgttaagttggtttcagtacccaaaatcgtgacg
atttttcgggttatgaagactttggaagagaatgctactgatcttgttgttcaatggcaa
aaggttgctccaaatactgatgataggcttttcatgaggcttctattgcagcctgtgact
tcaaaaaaagtgaaaaagagtaaaactgttcgtgcatctgttgtggctttgtttctagga
ggagttgatgaggttgtttcaattttgaggaatgagtttccacttcttggattgaagaaa
gaggattgtaatgaaacaagttggattggttctgttatttggtggaatgatgatgatgct
tttaacaatggtgcaaagccagagacccttttggataggaatctcaactcagcaagtttt
ggtaagaggaaatctgattatgtgcagaaagctatttccaaacatgatttggaatcaatt
tggaaaaagatgattgagcaaggaaaagttggatttgttttcaatccttatggtggaaaa
atggctgagattgcttctgatgctacaccatttcctcatcgtgcagggaatttgtttaaa
atccagtattctgtgaactgggatgatccatcagaagctgcagcacagaatttcacaaat
caggctaagaatcttcacagtttcatgaccccttttgtgtcaagtaatccaagaagtgct
tatataaattatagagacattgatattggtatcaatcattttgataagaatagctttgaa
gaagggaaagtttatggcactatctattttaataacaattttgatagactagtgaagatt
aagaatgcagtggatcctgaaaactttttcaggaatgaacaaagtattccagtacatgct
tag

DBGET integrated database retrieval system