KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109331178Help
Entry
109331178         CDS       T04664                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00020  Citrate cycle (TCA cycle)
lang00190  Oxidative phosphorylation
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
lang01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109331178
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109331178
Enzymes [BR:lang01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109331178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 109331178
NCBI-ProteinID: XP_019421070
LinkDB All DBs
Position
LG17
AA seq 628 aa AA seqDB search
MWRCVARRLGAPPASNRSSPRSIISRFFSSGESTSSYTVVDHKYDAVVVGAGGAGLRAAI
GLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDA
IQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLNYGKGGQAYRCACAADRTGH
ALLHTLYGQAMKHNTQFFVEYFALDLLMNNDGTCQGVIALNMEDGTLHRFQAASTILATG
GYGRAYFSATSAHTCTGDGNAMAARAGIPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGI
LRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGAHKDHIYLHLNHLPPDVLK
ERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDAIVPGLM
AAGEAACASVHGANRLGANSLLDIVVFGRACANRVSEIHRPGEKQKPLEKDAGQKTIAWL
DKLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKVEDRTL
IWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFKVRDDENWMKHTVGFWENE
KVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtggctcgtagacttggtgctccacctgcttctaacagatcctctcct
agatcgatcatttctagattcttctctagtggtgaaagcacgtcgtcgtatacggtggtg
gatcataagtatgatgcagttgtggtaggtgctggtggagctgggttgagagctgctatt
ggactttctgaacatggtttcaatactgcttgcattaccaagctcttcccaactcgttca
cacactgtcgcagctcaaggtggtataaatgctgcattgggaaatatgactgaggatgac
tggaggtggcacatgtatgacactgtcaagggaagtgattggctaggagatcaggatgcc
atccaatatatgtgtagggaggcaccaaaagcagtcattgagctcgagaattatggattg
ccattttcccgaactgaggaaggaaaaatatatcagcgtgcatttggggggcaaagcttg
aactatggaaagggtggtcaggcttaccgatgtgcatgtgctgctgatcgaactggacat
gctttattgcacactctatatggccaagccatgaaacataatacccagttctttgtggaa
tattttgcattggatcttttaatgaacaatgatggcacttgccaaggagtaattgccttg
aatatggaggatggaacattacatcgtttccaagctgcttcaacaattttggccacaggg
ggttatgggagagcatatttttctgctacctcggcacatacatgcactggagatggcaat
gccatggctgcacgtgctgggatcccacttgaggatttggagtttgtgcaatttcaccca
acaggtatatatggagcaggttgcctcatcacagaaggttctcgtggtgaaggtggaatt
cttaggaatagtgagggtgagcgatttatggaacgatatgctcccactgcaaaggatctc
gcatcaagagatgtagtttctagatcaatgactatggagattcgtgaaggtcgtggtgta
ggagcccataaagatcacatttatctccacttgaatcacttacccccagatgtgctgaag
gagagacttcctggtatctctgaaactgctgctatttttgctggtgtggatgtaacaaag
gaacccattcctgttctgccaactgtgcattataacatgggtggtattcccacaaatcac
catggagaggttgttaccattaaaggtgatgatccagatgcaatagttcctggattgatg
gctgctggggaagcggcatgtgcatcagtccatggtgccaataggcttggtgctaactca
cttctggacattgttgtttttggtagagcttgtgcaaatagagtttcagaaattcatagg
ccaggggagaaacaaaaaccattagagaaggatgctggtcagaaaacaattgcatggttg
gacaaattgagaaattcaaatggttcgttgccaacttctaaaattcggttgaatatgcaa
agagtaatgcaaaacaatgctgctgtgttccgtacgcaagaaacattagaagaaggttgt
caattaattgataaaacatgggagagtttccatgatgtcaaggttgaagaccgaactttg
atatggaactctgacttgattgagactattgagttggaaaatcttttaataaatgcctgc
atcacaatgcactctgctgaagccaggaaagaaagtagaggtgctcatgcccgtgaggac
ttcaaggtaagagatgatgagaactggatgaaacacactgttggattttgggaaaacgag
aaggtccggttagattacaggccagtgcacatgaatacactggatgatgaggttgaatca
ttccctcctaaagctcgtgtgtattaa

DBGET integrated database retrieval system