KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109332774Help
Entry
109332774         CDS       T04664                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lang00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109332774
Enzymes [BR:lang01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109332774
Chromosome and associated proteins [BR:lang03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109332774
   Polycomb group proteins
    PRC2-EZH2 complex
     109332774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 109332774
NCBI-ProteinID: XP_019423348
LinkDB All DBs
Position
LG18
AA seq 857 aa AA seqDB search
MASFLPSRSEPLVDLSTREADDASPAVKDVLLVIDSLKKHVAAERVVSVKKRMEENRQKL
VGVTNHLYNTSMDRRTCNITDSHSSLDLLEKRQKEAMDMHNGVHESNGDTESNGYHEDSH
GSTAVLLGSNVAVKNAVRPIKLPEVKRLPPYTSWIFLDRNQRMTEDQSVVGRRRIYYDQN
GGEALICSDSEEETMEDEEDKREFLESEDYILRMTVREIGLSDIVLDLLAQCFSRTTTEI
KARYETLSNEDNAGGGSKNANTEENSKCGNSFLEKDLEAALDSFDNLFCRRCLVFDCRLH
GCSQDLVSPAEKQSMWTPTDTESAPCGPNCFQLVLKSERFSKAPSTSQAGSEEKSSGGSS
SRKKSSARRQMKCSQSENASSNAKNISESIDSENGPGWDAVSASHLAPPTTKSVGRGGIG
KRNSKRVAERVLVCMQKRQKKTVASDSDFIGGALDQSSDDMVTTDSPVMSSEDNLRKEEL
VDENICKQEPTDNKSWKALEKGLLEKGMEIFGRNSCLIARNLLNGVKTCWEVFQHINCEE
GKMSGPGGDAENYFLEGYSKGNNEVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKRITDK
KDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP
CFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW
GAFLKNSVAKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKL
KFANHSPDPNCYAKVIMVAGDHRVGIFAKERIGAGEELFYDYRYEPDRAPAWARKPEASG
SKKDDGAPSSGRAKKLA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtttcttccttccagatcagaacctctcgtcgatctatctacaagagaagcg
gatgacgcaagtcctgctgttaaagacgtgttactggttattgattctttaaagaaacat
gttgctgctgaacgggttgtttccgtaaagaaaagaatggaagaaaatagacagaagctg
gttggtgtcacaaaccatctctacaatacatctatggacagaaggacctgcaacattact
gattcacacagtagtctggacctactggaaaaaaggcaaaaagaagcaatggatatgcac
aatggtgttcatgaaagtaatggtgatacagagagcaatggctatcatgaagatagccat
ggttctacagcagttcttctgggatctaatgttgctgtcaagaatgctgttcgccctatc
aagttacctgaagtaaaaagattacctccttacacctcatggatttttctggacaggaat
caaagaatgacagaggatcagtcggtggtgggtcggagacgaatctattatgatcaaaat
ggcggagaagcacttatttgcagtgatagtgaggaggaaacaatggaggatgaagaggac
aaaagagagtttttagaatcagaagattatatacttcgcatgactgtcagagaaattggt
ttatctgacattgttctggatttgctggcacagtgtttttctagaaccactactgaaatt
aaggcaagatatgaaactcttagtaatgaagacaatgctggtggtggttccaagaatgca
aataccgaagagaattctaaatgtggaaattcttttctggaaaaggatcttgaagcagct
cttgactcttttgacaaccttttttgccgacgatgtcttgtttttgattgcaggttacat
ggatgttcacaggatcttgtctctcctgctgagaagcaatctatgtggacccctactgat
acggaaagtgcaccttgtgggccaaactgttttcaattggtacttaaatcagaaagattt
tctaaagccccctctacttcccaggctggttcagaagagaaaagctctggtggttcttca
tctaggaagaagtcttctgctagaaggcagatgaaatgcagccaaagcgaaaatgcttca
tctaatgcaaagaacatttctgagagtattgactcagagaatggtcctgggtgggatgct
gtttcagcttctcatttggcaccaccaacaactaaatccgttgggagaggtggaattggt
aagaggaacagtaagcgagtggcagaacgtgttctagtttgcatgcagaagcggcagaag
aaaactgtggcctctgattctgatttcattggtggagctcttgaccagtcatcggatgac
atggttactactgactcaccagtcatgagcagtgaagacaacttgaggaaggaagagtta
gtggatgaaaacatttgtaaacaagaacccacagataataaatcttggaaagctcttgaa
aaagggcttctggagaaaggaatggaaatttttggtagaaacagttgcttaatagccagg
aatctcttgaatggtgtaaagacttgttgggaggtattccaacacattaattgcgaagaa
ggaaagatgtcaggtcctggcggggatgctgaaaattattttctcgaaggttattccaag
ggtaataatgaagtgaggcgaaggtcaagatttttacgtagaagaggaaaagttcgtcgc
ttgaaatatacctggaaatctgctgcttaccattcaatcaggaaaaggattaccgacaag
aaggatcagccctgccggcagtacaatccttgtggttgccaaacagcttgtggaaagcag
tgtccttgtcttctaaatggaacatgctgtgagaagtattgtgggtgccccaagagttgc
aagaatcgatttcgtggctgtcattgtgctaagagccaatgccgaagtcgtcaatgtcca
tgctttgcggcagatagagaatgtgatccagatgtttgtaggaattgttgggtcagttgt
ggtgatggtactcttgggattcctagccaaagaggtgataactatgagtgtagaaacatg
aaacttcttctcaaacagcagcagagggttcttcttggaaggtctgatgtatctgggtgg
ggagcgttcctaaagaatagtgttgccaagcatgagtaccttggagagtatactggagag
ttaatttctcatcgggaggcagataagcgaggaaagatatatgaccgtgaaaattcatct
tttctattcaatctgaatgatcagtttgttcttgacgcttatcggaagggagacaaattg
aagtttgcgaaccattctcccgatccaaattgttatgcaaaggttatcatggttgctggg
gatcatagggtaggcattttcgccaaggaaaggatcggcgctggagaggaactgttttat
gattaccgatatgagcctgatagagcacctgcttgggctcggaagccagaggcatctgga
tcaaaaaaagatgatggtgcaccatcaagtggtcgtgcaaagaagcttgcttag

DBGET integrated database retrieval system