KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109334511Help
Entry
109334511         CDS       T04664                                 

Definition
(RefSeq) probable nitronate monooxygenase
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
SSDB OrthologParalogGFIT
Motif
Pfam: NMO FMN_dh IMPDH DHDPS
Motif
Other DBs
NCBI-GeneID: 109334511
NCBI-ProteinID: XP_019425873
LinkDB All DBs
Position
LG19
AA seq 330 aa AA seqDB search
MGWKGILGFEYGIVQAPLGPDISGPHLVAAVANSGALAFLRSPDWESPDYLRELIRKTRS
LTNKPFGVGVVLAFPHEENLKVILDEKVAVLQVYWGDCTRELVVKAHSAGVKVVPQVGSF
EGAKKAIDAGVDGIIVQGREAGGHVIGQDGLISLVPRVVELVGDRDIPVIAAGGIVDARG
YVAALALGARGVCLGTRFVATNESYAHPSYKRKLVEMAETEYTNVFGRARWPGAPHRVLQ
TPFYKDWKSLPAHENEANQPVIGHSTINGVEKEIRRFAGTVPNVTTTGDLESMALYAGQG
VGLINEIISAGEVVKRLVEEAQLIIQQNFN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggttggaaagggatactaggttttgaatatggtatagttcaagctccattaggccct
gatatttctggtcctcaccttgttgctgctgttgccaattctggtgctcttgcctttctc
agatcccctgactgggaatcaccagattatttgagggagctcataaggaagactaggagc
ttaaccaataaaccattcggggttggtgtcgttctagcatttcctcatgaggagaacttg
aaggtcattcttgatgaaaaagttgcagtcttgcaagtttattggggtgattgtacaagg
gaattggtagttaaggctcattctgctggtgtcaaagttgttcctcaagtcgggagtttt
gaaggcgcaaaaaaggcaattgatgcaggtgttgatgggataattgtacaaggacgggaa
gccggtggtcatgtcattggtcaggatggtttgatttcattggtgccaagggtggtcgaa
ctagttggtgaccgagatatacctgttattgcagctggaggaattgtagacgctagaggc
tatgttgcggctctggcacttggtgcccgtggcgtctgtctgggcactaggtttgtcgca
acaaatgaaagctatgctcatccctcatacaaaaggaagttagttgaaatggccgaaacc
gagtacacaaatgtatttggtcgggcgagatggcctggtgcaccgcatcgcgtattgcag
acacccttctacaaggattggaaatcccttccagcacatgaaaatgaagccaaccagcct
gtcataggccactcaacaattaatggcgtggagaaagagattcggcgttttgctggtaca
gtcccgaacgtgacaactacaggagatcttgagagtatggctctgtatgctggccaaggt
gttggtctcatcaacgaaattatatctgctggtgaagtggttaagagactagttgaagag
gctcaacttattatacaacaaaactttaattaa

DBGET integrated database retrieval system