KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109339648Help
Entry
109339648         CDS       T04664                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00250  Alanine, aspartate and glutamate metabolism
lang00410  beta-Alanine metabolism
lang00430  Taurine and hypotaurine metabolism
lang00650  Butanoate metabolism
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109339648
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109339648
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109339648
   00430 Taurine and hypotaurine metabolism
    109339648
Enzymes [BR:lang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109339648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109339648
NCBI-ProteinID: XP_019432667
LinkDB All DBs
Position
LG02
AA seq 507 aa AA seqDB search
MVLSKTAPETDVSIHSTFASRYVRVSLPRFRMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMAAINKNYVDMDEYPVTTELQNRCVNIIAHLFNAPLEETEHAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKEEGKPYDNPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYILDPEKAIEMVDENTICVAAILGSTLNGEFEDVKRLNDLLSEKNTETGWNTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKLVMENCRDNMIVLKEGLEK
TDRFDIVSKDDGVPLVAFTLKDNSHFDEFQVSDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRALAERLVVDIQKVLHELEMLPSKLLTKTAITVAGDEGLNDDAKVVVVKKSALE
TQREITTAWKKFVMDRKKMNDKMNGVC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctccaaaactgcacccgagacagacgtctccatccactcaacatttgcctca
cgctatgtccgcgtttcccttcccaggttcaggatgccggagcagtcaatccccaaggaa
gctgcataccagatcataaatgatgaactcatgttggatggtaacccaaggcttaaccta
gcttcttttgttacaacctggatggagccagaatgtgataagctcatgatggctgccatt
aacaagaactacgttgacatggatgagtatcctgttaccactgagcttcagaatcggtgt
gttaacataatagctcatcttttcaatgcaccactagaagagactgaacatgcagttggt
gttggcactgttgggtcatctgaggctattatgttggctggattggcatttaaaaggaag
tggcagaataaaaggaaagaagaaggcaaaccctatgacaatcctaacattgttactggt
gccaatgttcaggtttgctgggagaaatttgcaaggtactttgaggtggagttgaaagag
gtcaagctgcgagaaggatactatatattggaccctgaaaaggccattgaaatggtggat
gagaacaccatttgtgttgctgccatccttggttccacactaaatggagagtttgaagat
gtcaaacgcttaaacgatctcctatctgaaaagaatacggaaactggatggaacacccca
attcatgtggatgcagccagtggtggattcattgcaccatttctttatccagaacttgag
tgggactttagattaccactagtgaagagcatcaatgttagtggacacaaatatggtctt
gtctatgctggaattggttgggtcatttggagaaacaaagaagaccttccagaggaactt
attttccacattaactatcttggagctgatcaacccactttcaccctcaacttctccaaa
ggttctagccaagttattgctcagtactaccaactaattcgtcttgggtatgaggggtat
aaacttgtaatggaaaactgcagagacaacatgatagtacttaaagagggactcgagaaa
acagatagatttgacattgtatccaaagatgatggtgtaccattggtggccttcactttg
aaggacaacagccactttgatgaattccaagtctctgatatgctgaggcgctttggttgg
atagtgccagcatacacaatgcccccagatgcacaacatgtaaccgtgcttcgcgttgtc
attagggaggacttttcgcgtgcccttgccgagcgcctagttgttgatatccagaaagtg
ttgcatgagctggaaatgcttccttcaaagctgctcactaagacagccataacggttgct
ggagatgaaggtttaaatgatgatgccaaagtggtggttgttaagaagagtgctctggag
acccagagagaaatcactacagcttggaagaaatttgttatggataggaagaaaatgaat
gacaagatgaatggtgtctgctag

DBGET integrated database retrieval system