KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109340436Help
Entry
109340436         CDS       T04664                                 

Definition
(RefSeq) hexokinase-2, chloroplastic-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00010  Glycolysis / Gluconeogenesis
lang00051  Fructose and mannose metabolism
lang00052  Galactose metabolism
lang00500  Starch and sucrose metabolism
lang00520  Amino sugar and nucleotide sugar metabolism
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
lang01200  Carbon metabolism
Module
lang_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lang_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109340436
   00051 Fructose and mannose metabolism
    109340436
   00052 Galactose metabolism
    109340436
   00500 Starch and sucrose metabolism
    109340436
   00520 Amino sugar and nucleotide sugar metabolism
    109340436
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109340436
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lang04131]
    109340436
Enzymes [BR:lang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109340436
Membrane trafficking [BR:lang04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109340436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 109340436
NCBI-ProteinID: XP_019433678
LinkDB All DBs
Position
Un
AA seq 497 aa AA seqDB search
MSVAATTYSAVGYSLFSGSQRRSTPRLKMSLRSDSFSVEPITVLTKLKHECATPLPLLQK
VADAMCAQMRAGLAADGGPGLPMLPTYVHDLPTGKEKGLFYALDLGGTNFRVLRVQLGGK
DERVIATEFEQVSIPQGLMFGTSNELFDFIALRLAKFAAKEHGRFHFLPGRKREIGFTFS
FPVNQTSIDSGILIKWTKGFAVSGTTGKDVVACLNEAMERQGLDMRVSALVNDTVGTLAG
AEYYDNDAMVAVILGTGTNACYVEQTSAIPKLQGHASSSGEMIISTEWGAFSNGLPLTEF
DREMDAASINPGEQIFEKTISGMYLGEIARRVLLKMAEVDGLFGNSAPQNLSKPFILGTP
DLCAMQQDNSGDLQAVGSLLYDKTGVEFNLSARKTVLEVCDTIVKRGGRLAGAGIVGILQ
KMEENSKSFISKKRVVVAIDGGLYANYPQYRAYLHDSVKELLGTEKSNKVVIEHTKDGSG
IGAALLAASNSIYKHDF
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgctgccaccacctactccgccgtggggtactctcttttttcaggatcccag
cggcggagtacaccacggttgaagatgtcactccgatcagactcattctctgtggagccg
atcacagtattgactaaactgaaacacgagtgtgccactcctctacctcttcttcagaaa
gtggctgatgccatgtgtgctcaaatgcgagctggtctagccgctgatggtggacctgga
cttccaatgttacctacctatgttcacgaccttcctactgggaaggagaaagggttgttt
tatgcattggatcttggtggaacaaacttccgtgtgctgagagtgcagttgggtggaaaa
gatgagcgtgtgattgccactgagtttgaacaagtatccatacctcaaggcctcatgttt
ggtacatccaatgaactttttgacttcattgctttaaggctagcaaaatttgctgcgaag
gagcatggaagatttcattttttgccaggaagaaagagagaaattgggttcacgttttca
tttcctgttaatcagacatctattgactctggcatattaatcaagtggaccaagggtttt
gcagtatctggaaccacagggaaagatgtggttgcttgtctgaatgaagcaatggaaagg
caaggacttgatatgcgagtttctgctctggttaatgatactgtgggaacattagcggga
gcagaatactatgacaatgatgccatggttgctgttattttgggtaccggaaccaatgct
tgctatgttgagcagaccagtgcaattccgaagttacaaggccatgcctcttcctctggc
gaaatgatcattagtacagagtggggagcattctcaaatggtctccctttaactgagttt
gatagagaaatggatgctgctagcatcaatcctggagagcagatttttgaaaagacaatc
tcaggaatgtacctaggtgaaattgccagacgagtgctactgaaaatggctgaagtggat
ggattgtttggaaattctgccccacaaaatctctccaagcctttcatactcgggacacca
gatctatgtgccatgcagcaggacaattctggcgatttacaagctgttggatctcttctc
tatgataaaactggggtcgaattcaatttaagtgcaagaaaaacagtgttagaagtttgt
gacacaattgtaaagcgaggtggaaggttagccggagctggaattgtggggattttgcaa
aaaatggaagagaactccaaaagtttcatatctaagaagagggtagttgtggccattgat
ggtggcttatatgcaaattatcctcaatacagagcatacttacatgattcagtgaaggag
ctactaggaacagaaaagtcaaataaagtggtaatagagcatacaaaagatggatctggt
ataggggcagcactattagcagcttcaaattccatatacaaacatgacttctag

DBGET integrated database retrieval system