KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109347075Help
Entry
109347075         CDS       T04664                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00630  Glyoxylate and dicarboxylate metabolism
lang00710  Carbon fixation in photosynthetic organisms
lang01100  Metabolic pathways
lang01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109347075
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109347075
Enzymes [BR:lang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     109347075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 109347075
NCBI-ProteinID: XP_019442353
LinkDB All DBs
Position
LG01
AA seq 170 aa AA seqDB search
MSAITFAAPVAAASFVGLKSNRSNLCPGIRSNAWNKNVVSNGSKTHCSMKTWNPIDNKKF
ETLSYLPPLSDDSIAKQIDNMLRKGWIPCIEFDKVGTVHRENSQMPGYYDGRYWTLWKLP
MFGCVDSSQVLKEIYECKQIYPNTYIRCLAFDNKRHSQSMAFIVHKPATS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctataacttttgcagctccggttgctgcggcaagctttgttgggttgaagtcc
aaccgttcaaatctttgtcctggtataagatccaatgcatggaacaaaaatgttgtctcc
aacggttctaaaactcactgctccatgaagacatggaatcccatcgataacaagaagttt
gagacactgtcctaccttcctcctctctcagatgactccattgcaaagcagattgacaac
atgctccgcaagggttggatcccttgcattgaatttgataaggtgggtactgttcataga
gagaatagccagatgccaggttactatgatggaaggtattggacattgtggaagctacca
atgtttggttgtgttgactcttctcaagtattgaaagagatttatgaatgcaaacagata
tatccaaatacatatatacgctgtttggcatttgataacaagcgccacagccagtccatg
gcttttatcgttcacaaacctgctacctcttga

DBGET integrated database retrieval system