KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109347866Help
Entry
109347866         CDS       T04664                                 

Definition
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00061  Fatty acid biosynthesis
lang00780  Biotin metabolism
lang01100  Metabolic pathways
lang01212  Fatty acid metabolism
Module
lang_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109347866
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    109347866
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lang01004]
    109347866
Enzymes [BR:lang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     109347866
Lipid biosynthesis proteins [BR:lang01004]
 Fatty acid synthase
  Component type
   109347866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thg1 Thiolase_N
Motif
Other DBs
NCBI-GeneID: 109347866
NCBI-ProteinID: XP_019443510
LinkDB All DBs
Position
LG01
AA seq 621 aa AA seqDB search
MNPTLFHFHSLIFYSLSSSLTLTHFTFFLSSHYPPLSITTFSIILIIIKIIIIIIIPLYI
YVSSSISFHNHSLLISPLSLLSLFLIIMSSPFCTWLMAACMSITCDSDHRYSSSKRRYRF
TNFTSSATSKFNTRLISSLYGSSIHGLITSLEPCTDYNASNTLSQLFRSNTTNFNRKQRR
LNSLSRSGKTVALQPDQEFTSTKKPLAKQRRVVVTGLGVVTPLGHDPDVFYNNLLNGASG
ISEIEGFDCADFPTRIAGEIKSFSTEGWIAPKLSKRMDKFMHYMLTAAKKALVDGGITKD
VMDELNKEKCGVLIGSGMGGMKVFSDSIEALRVSYKKLNPFCVPFATTNMGSAMLAIDLG
WMGPNYSISTACATSNFCILSAANHIIRGDVDVMLCGGSDAAILPIGLGGFVACRALSKR
NTDPAKASRPWDIDRDGFVMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTSDAYHVTE
PRPDGAGVILCIEKALAESGISKEDVNYINAHATSTPAGDLKEYQALIHCFGQNPELRVN
STKSMIGHLLGAAGAVEAVATIKAIKTGWIHPNINLENPDKGVDAKVLVGPTKERLDIKA
ALSNSFGFGGHNSSIIFAPYK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaacattgtttcatttccattctctcattttctattcactttcttcctcactc
actctcacccacttcaccttctttctttcctctcattacccacccctatccatcaccacc
ttttctattattcttattattattaaaattattattattattattattcctctatatata
tatgtttcttcttcaatctcttttcacaaccactctttattgatttcaccactttctctt
ctctctctttttctcatcatcatgtcttcccccttttgcacgtggcttatggctgcttgc
atgtctatcacgtgcgactctgaccaccgttactcttcttctaaacgacgttatcgtttc
accaatttcacttcttctgctacttccaaattcaacactcgtttgatttcttctctctat
ggatccagcattcatggtcttatcacttcacttgaaccttgcactgactacaatgcttct
aatacactctctcaactttttcgatccaatactaccaattttaaccgcaaacagaggcgt
ctcaattcactttctcgttctggtaaaacagtggctttgcaacctgaccaagaattcacg
tcaacaaaaaaacctcttgcaaaacaaaggcgagtagttgtgacaggcttaggtgtggtt
acaccacttggtcatgatccagatgtcttctacaacaatttactcaatggtgctagtggt
attagcgagattgagggttttgattgtgctgattttccaaccaggattgctggtgagatc
aagtctttctcaaccgaaggctggatagcaccgaaactttcgaagagaatggataaattt
atgcactatatgctaacagccgccaagaaagccttggttgatggtggaattaccaaagat
gtgatggacgagttaaataaagagaaatgtggagttttgattggctcaggaatgggtggc
atgaaggtttttagtgattctattgaagctttacgagtctcatataagaagttgaatcct
ttttgtgttccttttgcaacaacaaatatgggttctgccatgcttgcaattgatctggga
tggatgggccctaattattctatatctacagcttgtgctacaagtaacttttgtatactg
agtgcagcaaaccatatcattagaggtgatgttgatgtgatgctttgtggtggctcagat
gctgctattttaccaattggtttgggaggctttgtggcttgcagagcactctcaaagagg
aataccgatcctgccaaagcttcacgcccctgggatattgatcgtgatggatttgtcatg
ggagaaggggctggagttttacttttagaagaattggaacatgctaagaaaagaggtgca
accatatatgcagaattccttggtggaagcttcacctctgatgcatatcatgtgactgag
ccacgtcctgatggggccggagttatactttgcatcgaaaaagccttagctgagtctgga
atatcaaaagaggatgtgaattacataaatgcacatgccacatctacaccagctggagat
ctgaaggagtaccaggctctgattcattgttttggtcaaaaccccgagctaagagtaaat
tctacaaaatctatgattggccatctactaggggcagctggtgctgtggaagctgtagca
acaataaaggcaattaagacaggttggattcatccaaatatcaatctagaaaatccagac
aaaggagtggatgcaaaagtacttgttggtccaaccaaagagagactggatatcaaggct
gctttatctaattcatttggttttgggggtcacaattcttcaatcatatttgccccttat
aagtga

DBGET integrated database retrieval system