KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109348045Help
Entry
109348045         CDS       T04664                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109348045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lang02000]
    109348045
Enzymes [BR:lang01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109348045
Transporters [BR:lang02000]
 Other Transporters
  Pores ion channels [TC:1]
   109348045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_3 GST_C_5 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-GeneID: 109348045
NCBI-ProteinID: XP_019443780
UniProt: A0A1J7IBW8
LinkDB All DBs
Position
LG05
AA seq 218 aa AA seqDB search
MADEVVLLDFWLSPFGMRIRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHN
GKPICESLIAVQYIDEVWNDRSPLLPSDPYQRSQARFWADFVDKKIYEAGKKVWTTKGEE
QEAGKKEFIEALKAFEEELGDKPYFGGDKLGYVDIALVPFYTWFKGYETYGNINIESECP
KFIAWAKRCLQKESVSKSLCDQEKVLEFMVDIKKKLGI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgaagtggttcttcttgatttctggcttagtccttttggtatgaggatcaga
attgcacttgctgaaaagggtatcaagtatgagtataaagaagaggacttgaggaacaag
agtcctttactccttcaaatgaatccagttcataagaaaatcccagttctcatccacaat
gggaaacccatttgtgaatctctcattgctgttcagtatattgatgaagtttggaatgat
agatctcctttgttgccttctgatccttatcagagatctcaagcaagattctgggctgac
tttgttgataagaagatatatgaggctggaaagaaggtttggacaacaaaaggagaagaa
caagaagctggcaagaaggaattcattgaagcccttaaagcgtttgaggaagagttggga
gacaagccttattttggaggagacaagttaggatatgtggatatagcacttgttccattc
tacacttggtttaagggctatgaaacctatggaaacatcaatatagagagtgagtgcccc
aagtttattgcttgggccaaaaggtgtctgcagaaggagagtgtttcaaagtctctttgt
gatcaggagaaggtcttagagttcatggtggatatcaagaagaagcttggaatttag

DBGET integrated database retrieval system