KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109353801Help
Entry
109353801         CDS       T04664                                 

Definition
(RefSeq) histone deacetylase 5
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Brite
KEGG Orthology (KO) [BR:lang00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lang01009]
    109353801
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lang03019]
    109353801
   04131 Membrane trafficking [BR:lang04131]
    109353801
   03036 Chromosome and associated proteins [BR:lang03036]
    109353801
Enzymes [BR:lang01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109353801
Protein phosphatases and associated proteins [BR:lang01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109353801
Messenger RNA biogenesis [BR:lang03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     109353801
Membrane trafficking [BR:lang04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    109353801
Chromosome and associated proteins [BR:lang03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109353801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl E6
Motif
Other DBs
NCBI-GeneID: 109353801
NCBI-ProteinID: XP_019451711
LinkDB All DBs
Position
LG01
AA seq 656 aa AA seqDB search
MASVVTNNGNEVNGQRRVGLIYNDRMCDHFSLQDHHHPEAPDRIRVIWNKLNKTGICDRC
VILDAKEAEDKYIQLVHSKSHVNQIKHISTKQYDSRRHKIALKLNSIYFNEGSSKAAYLA
AGSAVEVVEQVASRQLHSAVAIVRPPGHHAEHNEAMGFCLFNNVAISASYLLDERPELGI
KKILIVDWDVHHGNGTQKTFWNDSRVLFFSVHRHEFGTFYPCGDDGFYTMVGEGAGAGYN
INVPWENGRCGDADYFAVWDHILLPVAKEFNPDIIIVSAGFDAAVGDPLGGCLITPFGYS
ILLEKLMNFAEGRIALVLEGGYNLDSIANSMHACVEVLLDGKPVTESSKAYPFESTWRVI
KAVRQELSPFWPCLASELPKDLICLVAPPPHTLISSSDSEAEDDMDPLNSDNLGELLQDL
IIPLSNLKVDTDQVIGTSNTWRSELSNTYVWYASYGSNMWKSRFLCYVAGGQVEGMQKHS
SGSVDKAPPKEILWKTFPCRIFFGRNSSKSWGPGGVTFLNPERTFQHNTYLCLYKISLEQ
FNDVLLQENGLSLNVGSPLFDITALNAISEKEFNSSEAVKGSWYGDVVYLGKEQNIPILT
MTCSFLDIERFKAGELPLNAPNKAYANTLIKGLVEGEQLSEVEAIAYIEEAAAKPL
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgtggttacgaacaatggtaacgaagtcaacggtcaacgacgtgttggttta
atctacaatgacagaatgtgcgaccatttcagtttacaagatcatcatcatcccgaagcc
cctgatcgaatcagagtcatatggaacaagcttaacaaaactggtatctgcgatcgatgt
gtgattttggatgccaaagaagctgaagacaaatacatacagttggtgcactccaaaagt
catgtaaatcagattaagcacatcagcacaaaacaatacgattctcgaaggcataagatt
gcgttaaaactgaattctatatattttaatgaaggttcatcaaaagctgcttatcttgct
gctggctctgctgttgaggttgttgaacaagtggcaagcaggcaattgcattctgctgtt
gctattgtgaggcctccaggtcatcatgctgaacataatgaagccatgggattctgtcta
ttcaacaatgttgcaatatctgcttcttatctcttagatgaaagaccagaattaggtatc
aagaaaattttaattgttgattgggatgtccatcatggaaatggtactcaaaaaacgttc
tggaatgattctcgtgtcttattcttctctgttcacaggcatgaattcggaactttttat
ccgtgtggtgatgatggcttttataccatggttggagaaggagccggggctggatataat
ataaatgtaccctgggagaatgggagatgtggtgatgctgattactttgcagtgtgggac
cacattttgctcccggttgccaaagaatttaatccagacataattattgtctctgctgga
tttgatgcagctgttggtgaccctctgggaggatgtctaatcacaccatttggttattct
attctgttggaaaagttgatgaatttcgctgaaggtaggattgcactggttttagaagga
ggatataatctggactccattgcaaactcaatgcatgcttgtgttgaagttttgcttgac
ggcaaacccgttaccgaatcttcaaaggcttacccatttgagtccacatggcgtgtgatt
aaagcggttcgtcaggagttaagtcccttttggccttgtcttgctagtgaattaccaaaa
gatttaatttgtctagttgcaccacctccgcatactcttatttcaagctccgactctgag
gcagaggatgacatggatcccctcaattctgataaccttggagaacttcttcaggatctc
ataataccgctatctaacctgaaagttgatacagatcaagtgattggtacttctaatact
tggcgatcagaactgtcaaatacttatgtatggtatgcctcttatggatcaaatatgtgg
aaatcaagattcttgtgttatgtagcaggtggacaggtggaaggtatgcaaaagcactct
tctggttcagtggacaaagctccaccaaaggaaatcctttggaagactttcccttgccgt
atattttttggtcgcaattcttccaagtcatggggtcctggaggggtcacatttcttaat
cctgagagaacttttcagcacaatacctacctatgcctgtacaaaatttcgctagagcag
ttcaatgatgttttacttcaggaaaacggtttaagccttaatgtgggttctcctttattt
gatataactgcccttaatgctatctctgagaaggagttcaattcttcagaggctgtcaag
ggttcttggtatggtgatgttgtctacttaggaaaggagcagaatatcccaattcttacc
atgacgtgttcatttctcgatattgaacgctttaaagcgggggagctgccattaaatgct
cctaataaagcatatgccaacaccttaattaaagggttggtagagggagaacaactttca
gaggtggaagccattgcttacatagaagaagctgctgctaaacccttgtaa

DBGET integrated database retrieval system