KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109356141Help
Entry
109356141         CDS       T04664                                 

Definition
(RefSeq) DNA ligase 6-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang03030  DNA replication
lang03410  Base excision repair
lang03420  Nucleotide excision repair
lang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109356141
   03410 Base excision repair
    109356141
   03420 Nucleotide excision repair
    109356141
   03430 Mismatch repair
    109356141
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lang03032]
    109356141
   03400 DNA repair and recombination proteins [BR:lang03400]
    109356141
Enzymes [BR:lang01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109356141
    6.5.1.6  DNA ligase (ATP or NAD+)
     109356141
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109356141
DNA replication proteins [BR:lang03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109356141
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109356141
DNA repair and recombination proteins [BR:lang03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109356141
   NER (nucleotide excision repair)
    Other NER factors
     109356141
   MMR (mismatch excision repair)
    Other MMR factors
     109356141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 109356141
NCBI-ProteinID: XP_019455023
LinkDB All DBs
Position
LG09
AA seq 664 aa AA seqDB search
MLSGTKFYPFILFHHHHNNHAFSIQTPKNPNLHPQIPPPPTXPPLPPPPPHSKLIPNTRF
LVDTFHHTTTTSPSFSYFLSHFHSDHYSGLSSNWSHGLIYCSATTARLLIQILHIPPSFV
VPLPLRQPFHIDGAEVTLIDANHCPGAVQFLFSIPTGERFVHTGDFRFCKSMILEPSLAP
FIGADAVFLDTTYCNPKFVFPSQDESIEYIVDVVERVRVQCDDDDDNVLFLVAMYVIGKE
KILLELARRFNRKIHVDAREMEVLRVLGYGESGVFTEDRLESNIHVVGWNVLGETWPYFR
PNFVRMKEIMSERGYSKVVGFVPTGWTYEVKRNKFVVKSKDSFEIHLVPYSEHSNYEELG
EYVKFLRPKRVIPTVGLDVEKSDSKHADKMRKYFAQLIDEMANKPEFLRGFHCASGEVGS
KAEKDVSDDDTLKPGQNMGKEVESSDMEVHKSINPNSDVNLPSFTGEPCTGSPTLLTDEE
KDKIIQELSCCLPTWVTRSQLLDLISISENNIVEAVSYFYERETEFHQQALSCQASVALS
KCCTLTESDSPSKACLNTNNDHNFFDISPIQGPICLNTKNTPKNVVIFSSQDSKSANLRH
TAVPSSISPAKKKRGSASKPSKKVKVKAKSESSSSKQFTITKFFSKALPKNETPSVTQSD
HCSS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgcttagtggaactaagttttatccattcattcttttccatcatcaccacaataatcat
gcattctcaatccaaaccccgaaaaaccctaacctccacccacaaatccctccacctcca
accnnaccaccattaccgccgccgccgccgcactccaaactgatccccaacacccgcttc
ctcgtcgacaccttccatcacaccaccaccacctccccctccttctcctacttcctctcc
cacttccactccgaccactactccggcctctcctccaattggtcccacggcctcatctac
tgctccgccaccaccgcccgcctcctcattcaaatcctccacatccctccctccttcgtc
gtccccctccccctccgccaacccttccatatcgacggcgccgaagtcacgctcatcgac
gccaatcactgccccggcgccgtccaatttctcttcagcatccctaccggcgagagattt
gtccataccggcgatttcaggttttgtaagtcaatgattctagaaccttctcttgctcca
tttattggtgctgatgctgtttttttggatactacttattgtaaccctaagtttgtgttc
ccttcacaagatgaatctattgagtatatagttgatgttgtagagagggttagggttcaa
tgtgatgatgatgatgataatgtgttgtttcttgttgctatgtatgttattggtaaggag
aagattttgcttgagcttgctcggcggtttaaccggaagattcatgtggatgctagggaa
atggaggttttgagggttttagggtatggagagagtggtgtgtttacggaggatcgtttg
gagagtaatattcatgtcgttgggtggaatgtgttgggggagacgtggccgtactttagg
ccgaatttcgttagaatgaaagagattatgagtgagagagggtactcgaaggttgttgga
tttgttccgactggatggacttatgaagtgaagcgcaataaatttgtggtgaagtctaag
gattcatttgagattcatcttgtgccgtatagtgagcattcgaattatgaggagctgggg
gaatatgtgaagtttttgagaccgaagcgtgttattccgacggtaggtttagatgttgag
aaaagtgatagtaaacatgctgacaaaatgagaaagtattttgctcagctaattgatgag
atggccaacaagccggaatttttaaggggttttcattgtgcctctggggaagtcggttcc
aaggctgagaaggatgttagtgatgatgacactctgaaaccagggcagaacatgggaaaa
gaagtcgagtcatctgacatggaagttcataaaagcattaatccaaatagtgatgtgaat
ttgccctcgtttacaggtgaaccttgtacgggaagtcctactttacttactgatgaagaa
aaagataaaatcattcaagaacttagttgttgtttgcccacatgggtcactcgaagccag
ttgttagatctgatcagcatctcagagaacaatattgttgaagctgtttcttatttctat
gaacgtgaaactgaatttcatcagcaagcattgtcatgtcaagcttctgttgcattgtcg
aaatgctgcacattaactgaatctgattcaccttcaaaagcatgcctgaatacaaacaac
gatcacaatttttttgacatttctccaattcaaggccctatatgcctgaatacaaaaaac
actcccaaaaatgttgtcattttttcaagtcaagactctaaatcagctaacctgagacat
acagcagtacctagttccatttcccctgctaaaaagaagagaggtagtgcgagtaagccc
agcaagaaagtaaaggtcaaggcaaaatcagaatcaagtagttcgaagcagttcacgata
acaaaattctttagcaaagcactgcctaaaaatgagacacctagtgttactcaatcagat
cattgtagttcttga

DBGET integrated database retrieval system