KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109356150Help
Entry
109356150         CDS       T04664                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00562  Inositol phosphate metabolism
lang01100  Metabolic pathways
lang04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109356150
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109356150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lang01009]
    109356150
Enzymes [BR:lang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109356150
    3.1.3.48  protein-tyrosine-phosphatase
     109356150
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109356150
Protein phosphatases and associated proteins [BR:lang01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109356150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 PTPlike_phytase Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 109356150
NCBI-ProteinID: XP_019455032
UniProt: A0A4P1R9T6
LinkDB All DBs
Position
LG09
AA seq 630 aa AA seqDB search
MGLKISKPGQPKINHRLSLQDHMINYLAKNFIRNLVSKQRRRMLIAGYDLDMSYITDRVL
AMSFPSERMRAMYRNPLWQVKSVLDMRHQDHYKIYNLCIEESYDPTHFYGRVEAYPFDDN
HVPPLEMIKAFCESVDSWLSSDPKNIAVIHCMAGKGRTGLMVCAYLTYCGMSADEALQLY
ADRRTTNNEGVSIPSQRRYVGYWESVLSVPRGAGNGAPIVNLPPSCSRELRRIRLYDTVN
IDTVFFVISELQQVPNQVYRPSVEVSRSCCRQVKKGYQRTNSPRYYISYVEGDENGNQTE
QEEPRIVVQMDTESPIIYKKSCLDHYFDQPIKVTGDVRVIFYEKMIGGRLFYCCFNTAFI
RNSLLQAGKGRTGLMVCAYLTYCGMSADEALQLYADRRTTNNEGVSIPSQRRYVGYWESV
LSVPRGAGNGAPIVNLPPSCSRELRRIRLYDTVNIDTVFFVISELQQVPNQVYRPSVEVS
RSCCRQVKKGYQRTNSPRYYISYVEGDENGNQTEQEEPRIVVQMDTESPIIYKKSCLDHY
FDQPIKVTGDVRVIFYEKMIGGRLFYCCFNTAFIRNSLLQLTIRDLDKVGKKGRSICGPA
FCVELLFGPANTGLSSSSISIGDTFSDDTF
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggggttgaaaatttcaaagccaggccagcccaaaattaatcataggctgagtttacaa
gatcacatgataaattacctagccaagaattttattcgtaacttggtatctaagcaacgt
agaagaatgctaattgctggttatgatcttgacatgtcatatatcacagatagggtatta
gccatgtcatttccttcagaacgtatgcgtgcaatgtatcgaaatcctctttggcaagtc
aaatctgtcttggacatgagacatcaagaccattataagatctataatctatgtatagaa
gaaagttatgacccaacacacttttatggacgtgtagaagcatatccattcgatgataac
catgtgccacctcttgaaatgatcaaagctttctgtgaaagtgtggattcatggctgtca
agtgacccaaaaaatattgcagttatacattgcatggcagggaaggggagaactggctta
atggtgtgtgcatacctaacttattgtggcatgtcagcagatgaggctcttcaattgtat
gcagatagaagaacaacaaataatgaaggagtatcaataccaagccagcgtcgttatgtg
ggatattgggagagtgtgctttctgtgcctaggggtgctggaaatggagcaccaattgtg
aacttgcctccatcatgcagcagagaattgaggcgaataaggctttatgatactgttaac
attgacactgtattctttgtcatctcagagctacaacaggttcctaatcaggtttatcgt
ccttcagtggaagtttctcgaagctgttgcagacaggttaagaaaggttatcagagaacg
aatagtcctcgatattatatttcttatgttgaaggtgatgaaaatggaaaccaaacagaa
caagaagaacctcgtattgtagttcaaatggacacagagagtcctataatatacaaaaaa
tcatgtctagaccattattttgaccaacctataaaagtaactggagatgtacgtgtcatc
ttctatgagaaaatgataggaggccgtcttttctattgctgttttaatacagcctttatc
aggaacagcttacttcaggcagggaaggggagaactggcttaatggtgtgtgcataccta
acttattgtggcatgtcagcagatgaggctcttcaattgtatgcagatagaagaacaaca
aataatgaaggagtatcaataccaagccagcgtcgttatgtgggatattgggagagtgtg
ctttctgtgcctaggggtgctggaaatggagcaccaattgtgaacttgcctccatcatgc
agcagagaattgaggcgaataaggctttatgatactgttaacattgacactgtattcttt
gtcatctcagagctacaacaggttcctaatcaggtttatcgtccttcagtggaagtttct
cgaagctgttgcagacaggttaagaaaggttatcagagaacgaatagtcctcgatattat
atttcttatgttgaaggtgatgaaaatggaaaccaaacagaacaagaagaacctcgtatt
gtagttcaaatggacacagagagtcctataatatacaaaaaatcatgtctagaccattat
tttgaccaacctataaaagtaactggagatgtacgtgtcatcttctatgagaaaatgata
ggaggccgtcttttctattgctgttttaatacagcctttatcaggaacagcttacttcag
ctcacaataagggacttggacaaagttgggaagaaaggaagatcaatatgtggtcctgca
ttttgcgtcgaattactcttcggccccgcgaatacaggactttcatcatcaagcatatcc
attggtgacacttttagtgatgatacattctaa

DBGET integrated database retrieval system