KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109357617Help
Entry
109357617         CDS       T04664                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00620  Pyruvate metabolism
lang00710  Carbon fixation in photosynthetic organisms
lang01100  Metabolic pathways
lang01200  Carbon metabolism
Module
lang_M00168  CAM (Crassulacean acid metabolism), dark
lang_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
lang_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
lang_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:lang00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    109357617
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109357617
Enzymes [BR:lang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109357617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109357617
NCBI-ProteinID: XP_019457132
UniProt: A0A1J7GS78
LinkDB All DBs
Position
LG10
AA seq 966 aa AA seqDB search
MTSSNIEKMTSIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILHDLHGQDIRKTVQDC
YELSAEYEGKHKPEKLEELGNMLIGLDAGDSIVIAKSFSHMLSLANLAEEVQIAYRRRIK
LLKKGDFADENSAITESDIEETFKRLVAELKKSPEEVFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREVQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYFSQIEDLMFELSMWRCNDELRVRADELHRSSKRDAKHYIEFWKKI
PPNEPYRVILGEVRDKLYNTRERSRQLLANGTSEIPEETTFTNVEQFLEPLELCYRSLCA
CGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTNVMDAITKHLEIGSYREWSEEA
RQEWLLSELSGKRPLFGPDLPTTEEIADVLETFNVIAELPSDNFGAYIISMATSPSDVLA
VELLQRECHVKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYRNRIDGKQEVMIGYSDSG
KDAGRLSAAWALYKAQEELVKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIN
GSLRVTVQGEVIEKSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALLDEMAVIAT
EEYRSIVFQEPRFVEYFRCATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGTAFKHAIEKDPKNLRILQDMYNQWPFFRVSLDLVEMVFAKGDPGIAALYD
KLLVSEELLPFGEHLRATYEETKSFLLKVAGHKDLLEGDPYLKQRLCLRDSYITTLNVLQ
AYTLKRIRDPDYHVKLRPHLSKDYMESTKPAAELVKLNPKSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgactagtagcaacattgagaaaatgacttcaattgatgctcagttaaggcttctagca
ccaaggaaggtctctgatgatgataaacttgtggaatatgatgctttgttattggatcgc
ttccttgatattcttcatgatttgcatggtcaagacattaggaaaacggttcaagattgt
tatgagctatcagctgagtatgaagggaagcataagcctgagaaattggaggaacttggg
aatatgttaattggtcttgatgctggggattctattgtcattgccaaatcattttctcac
atgcttagtttggccaacttggcagaagaagttcaaattgcctaccgaagaaggatcaag
ttattaaagaagggtgattttgctgatgagaactctgccataaccgagtcagatatcgaa
gagaccttcaagcggctcgtggccgaacttaagaagtcccccgaggaagtctttgatgcc
ttgaagaaccaaactgtagatttggtcctaactgctcatcctactcagtctgttcgtaga
tctttgctgcaaaaacatggaaggataaggaattgtttaacacagttgtatgctaaagat
ataacaccagatgataagcaggaacttgatgaggctttacaacgagaggttcaagctgca
tttcgcacggacgagattcgaaggactcctcctacaccacaagatgagatgagggcagga
atgagctactttcatgagacaatctggaaaggtgtaccgaagtttttgcgccgggttgac
acagctctgaagaacattggaataaatgagcgtgttccatacaatgcccctcttattcaa
ttctcttcttggatgggaggagatcgtgacggtaacccccgggtaacccctgaagttaca
agagacgtgtgcttgctggctagaatgatggctgctaatttgtatttctctcagatagag
gatctcatgtttgagttatcgatgtggcgctgcaatgatgagctccgcgttcgtgctgat
gaactccataggtcctcaaagagagacgctaaacattatattgagttttggaaaaagatt
cctccaaatgagccataccgtgttattctcggtgaagtaagggacaaactgtataatact
cgtgaacgttctcgccagttattagccaatgggacctctgaaatccctgaagagacaacc
ttcacaaatgttgagcagtttctggagcctcttgaactctgttataggtcactctgtgca
tgtggtgaccgaccaatagcagatggaagccttcttgatttcttgcggcaagtctctaca
tttggactttcgcttgtaagacttgacatccgtcaagaatctgataggcacaccaatgtt
atggatgcgattacaaaacacttggagattggatcttaccgagaatggtctgaggaggcc
aggcaggaatggctcttgtccgagctcagtggaaagcgccctctctttggccctgatctt
cctactacagaagaaattgctgatgtcttggaaacgttcaatgtcattgcagaacttccc
tctgacaattttggtgcctatatcatctcaatggcaacatccccatctgatgtgcttgct
gttgagcttttgcaacgtgaatgtcatgtgaagcagccattaagggtcgtcccattgttt
gaaaagctcgctgatcttgaagctgctcctgctgcagtagcccggcttttctctatagat
tggtacagaaaccgtattgatggtaagcaagaagtcatgataggatactcagactcggga
aaagatgcaggtcgtctttctgcagcttgggcactctacaaggctcaagaagagcttgta
aaggttgcaaaagaatttggtgtaaagttgacaatgttccacggcagaggagggactgtt
ggaagaggaggaggtcctactcatcttgctatactgtctcagccaccagatactattaat
ggctcgcttcgtgtaacagttcaaggtgaagttattgaaaagtcatttggagaggagcac
ttatgctttaggacacttcagcgtttcactgctgctacactcgagcatggaatgcatcca
cctgtgtcaccaaaaccagaatggcgtgctctcttggatgagatggctgtcattgcaaca
gaggagtatcgctctattgttttccaggaacctcgttttgttgaatacttccgatgtgca
actcctgagctggagtatggacgaatgaacattggcagtcgtccatcaaaacgaaagccg
agtggaggaatcgaatcactccgtgctattccttggatttttgcttggacacaaacaagg
tttcacttaccagtatggcttggctttgggacagcattcaagcatgcaatcgagaaggat
ccgaagaatcttcgaatccttcaagacatgtacaatcaatggcctttcttcagggtcagc
cttgacttggttgaaatggtgtttgccaaaggagatccaggtattgctgccctatatgac
aaactcctagtgtcagaagagttattgccatttggtgagcatttaagggctacctatgaa
gaaaccaagagctttctcctcaaggttgctgggcacaaagatcttcttgaaggtgacccc
tacttaaagcaaagactatgtcttcgcgactcgtacatcacaaccctgaatgtcttgcaa
gcctacacgctgaagcgaattcgtgatcctgattaccatgtgaagctgaggccacacttg
tcaaaggactacatggaatcaaccaaaccagctgcagagctagtgaagcttaatccaaaa
agtgagtatgcccctggtttggaagatacccttattttgacaatgaagggtattgctgct
ggcatgcaaaatactggttaa

DBGET integrated database retrieval system