KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109360965Help
Entry
109360965         CDS       T04664                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00010  Glycolysis / Gluconeogenesis
lang00020  Citrate cycle (TCA cycle)
lang00620  Pyruvate metabolism
lang01100  Metabolic pathways
lang01110  Biosynthesis of secondary metabolites
lang01200  Carbon metabolism
Module
lang_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109360965
   00020 Citrate cycle (TCA cycle)
    109360965
   00620 Pyruvate metabolism
    109360965
Enzymes [BR:lang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     109360965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MRVI1
Motif
Other DBs
NCBI-GeneID: 109360965
NCBI-ProteinID: XP_019461766
UniProt: A0A1J7HKK2
LinkDB All DBs
Position
LG11
AA seq 477 aa AA seqDB search
MASLFLPTTLAATSNSKTTLSFSSSLSSTPFPLRRFSVAKTRRRQSSAIQSKIREIFMPA
LSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPV
GAPIGLLAETEAEVAEAKAKAAKSASASAPAAPIPQETSNPAPSISPPPSKAVSDGPRKT
VATPNAKKIAKQHKVNIESVVGTGPFGRVTAADVEAAAGITPTVSNVASPAVTSAPRKAA
AALVASTSAPAPIPGSSVVPFTTMQSAVAKNMVESLSVPTFRVGFPLTSDALDAFYEKVK
PKGVTMTAILAKAAAMALVQHPVVNATCKDGKSFTYNSNINIAVAVAINGGLITPVLPDA
DKLDLYLLSKKWKELVNKARAKQLQPQEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMA
VGASKPTVLADKDGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIVENPESLTL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactttttctcccaaccactctcgctgccacctcaaattccaaaactaccctt
tccttctcttcctctctctcctccactcccttccccttgcgccgtttctccgtcgctaaa
actcgccgccgccaatcctccgcaatccaatccaagatcagggaaatcttcatgcccgcc
ctcagctccaccatgaccgagggcaaaatcgtctcttggatcaaatctgagggtgatgtt
ctctccaaaggcgagagtgtcgttgtcgttgaatccgacaaggctgacatggacgttgag
acattttacgatggtatcctcgctgccattgtagtcggcgagggcgaaactgctcccgtc
ggcgctccgatcggtcttcttgctgagaccgaggcggaagtggcagaggccaaagccaag
gctgccaaatccgcctccgcctctgcacccgcagctccaattcctcaggaaacttcgaat
cctgctccgtcaatttctcctccgccatccaaggcggtttccgatgggccgagaaagacc
gtggcgacaccaaacgcgaagaagatcgcgaagcagcataaggtgaacattgaatcggtg
gttgggactggtccgttcggtcgggttactgctgcggatgttgaggccgctgccggaatt
acaccgactgtgagtaatgtggcatctccggcagtgacttcagctccacggaaggctgca
gctgctctggtagcttcgacttctgctccggctccaattccaggttctagtgttgttccc
ttcaccacaatgcaatccgcggttgcaaagaacatggtggagagtctctctgtacctacg
ttccgtgttgggtttcctttgaccagtgatgcacttgatgcattctatgagaaggtgaaa
ccaaagggggtgacaatgacagcaattctagcgaaggctgctgcaatggcactggttcag
catccagtagtgaatgctacttgcaaagacgggaagagttttacatataatagtaatatt
aacattgctgtagcagtggcaatcaatggtggtttgattacccctgttcttcctgatgca
gataagctggacctgtaccttttgtctaaaaaatggaaggagttagtgaacaaagctcgg
gctaagcaattacaacctcaagagtataattcaggaactttcacactttcaaatttagga
atgtttggagttgacaggtttgacgccatacttcctccaggccagggcgctatcatggct
gttggagcatcaaagcctaccgttttggcagataaggatggattctttagcgtcaaaaat
aaaatgctggtgaatgtaactgctgatcatagaataatctacggggctgacttggctgca
ttccttcagacattctcgaaaattgttgaaaacccagaaagcttaaccttatag

DBGET integrated database retrieval system