KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109361277Help
Entry
109361277         CDS       T04664                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
lang00564  Glycerophospholipid metabolism
lang01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lang00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109361277
Enzymes [BR:lang01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     109361277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox GIDA HI0933_like Pyr_redox_3 NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 109361277
NCBI-ProteinID: XP_019462224
UniProt: A0A1J7H4G5
LinkDB All DBs
Position
LG11
AA seq 629 aa AA seqDB search
MTATTRLRRLGTVVGAAAAVCGGAILLHSPISVSDGGGSHLASVQQKIHDPFAAVPSREV
QRSSLIGTSTANPLDVLVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGSSSRSTKLIH
GGVRYLEKAVFKLDYGQLKLVFHALEERRQVIDNAPHLCHALPCMTPCFDWFEVVYYWIG
LKMYDLVAGARLLHLSRYYSAKESTELFPTLATEGKGRSLRGTVVYYDGQMNDARLNVGL
ACTAALAGAAVLNHAEVLSLLKDDASERIIGARIRDNLTGKEFDTYARVIVNAAGPFCDA
VRKMADKDARDMICPSSGVHIILPDYYSPVGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTPITFLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAMDPSAKNTESISR
DHVVFEDHPGLVTITGGKWTTYRSMAEDAVNAAIRSGKLTPSNGCVTNNLRIVGGEGWDP
AFFTVLTQQYMRMKLSSKGKIVPGIMDSAAAKHLSRAYGTLAERVAAIAQNENLGKRLAH
GYPFLEAEVAYCARHEYCESAIDFIARRSRLAFLDTDAARRALPRVIQILAAEHKWDKSR
QKEELQNAKAFLETFKSSKNAQFHDGKHH
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaccactcgcctgaggcgactcggcaccgttgtcggagcagccgccgccgta
tgcggcggcgcaatcctacttcactctccaatctccgtctccgatggaggaggttctcac
ctcgcctctgtccagcagaagatacatgatcccttcgccgctgtcccctcgagagaagtc
cagcgatcgtcgctgatcggcacaagcacggccaaccctctcgacgtcctcgtcatcggc
ggcggagccacgggttccggcgtggcgctagacgctgtgacccgaggactccgagtcggt
ctcgttgagagagaggatttctcttccggaagttcctcccgttccacgaaactcatccat
ggaggtgttcgctacttggagaaagctgtctttaaacttgactatggtcaattgaagtta
gtattccatgcacttgaggagcgtagacaggttattgacaatgcaccgcacctatgccat
gctttgccttgcatgacaccgtgttttgactggtttgaagtagtttactactggattggc
ttgaaaatgtacgatttggtcgcaggtgcacgactcttgcacttatcaagatattattct
gcaaaggagtcaacggagctctttcccactctggcaacggagggaaaaggcagaagtctg
aggggtacagttgtttattatgatgggcagatgaatgatgcacgacttaatgttggattg
gcttgcactgctgcattagctggtgcagcggtgctgaaccatgccgaagtgttatcctta
ctgaaggatgatgctagtgaacggataattggtgcgcggattagggacaatttaactggc
aaagagtttgatacatatgcaagagtaattgtaaatgcggctgggccattttgtgatgct
gtaaggaaaatggctgacaaagatgcaagagatatgatctgtccaagcagtggtgtacat
atcatactccccgattattattctcccgttggaatgggtttgattgttcctaaaactaag
gatggtcgtgttgtttttatgctgccatggctgggacgaactgttgctggaactacagat
tccaacacccccattactttccttcctgaaccacatgaagatgaaattcagtttatattg
gatgccatatctgattaccttaatgttaaagttcggcgtactgatgttctttctgcatgg
agtggcattcgcccattagcaatggatccttctgctaaaaatactgagagcatctccagg
gaccatgttgtctttgaggatcaccctggtttggtcaccatcactggtggcaagtggact
acctaccgcagcatggcagaagatgctgttaatgctgctataaggtcagggaagctgact
ccctcaaatggatgtgtgaccaacaatctccggattgttggcggtgaagggtgggatcct
gctttctttacagttctcactcaacagtatatgcgcatgaaattatcatctaagggtaaa
attgttcctgggataatggacagtgctgcagcaaagcacttgtctcgcgcatatggaaca
ttggctgaacgtgtggctgccattgctcagaatgaaaatttgggtaagcgacttgcccat
ggttacccttttctggaggctgaggtggcctactgtgctcgtcatgagtactgtgaatct
gctatcgacttcattgcaaggaggagtcgtctcgctttccttgacactgatgcagcccgg
cgggcattaccacgtgtgattcaaatattggcagctgagcacaaatgggacaaatcaagg
cagaaggaagagttgcagaatgctaaggcatttttggagactttcaaatcctcaaaaaat
gctcagttccatgacgggaaacaccattag

DBGET integrated database retrieval system