KEGG   Lentibacillus amyloliquefaciens: AOX59_10490Help
Entry
AOX59_10490       CDS       T04204                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
lao  Lentibacillus amyloliquefaciens
Pathway
lao00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:lao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AOX59_10490
Enzymes [BR:lao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AOX59_10490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ALX48987
UniProt: A0A0U3NQJ4
LinkDB All DBs
Position
complement(2096077..2097573)
Genome map
AA seq 498 aa AA seqDB search
MSKALLKTDNLQNFIDGEWVEKHESAPVINPANGKTIVDVPLSDEKDVSKAVEAAGKAQK
EWALVPAPQRAEVLFKAGQMMKERKERLSQLLTMENGKVLEEARGEVQEGIDMAFYMAGE
GRRLFGHTTPAELPNKFSMSQRAPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVIWKPA
TETPIMAYELAKILEEAGLPKGIMNVVNGRGSAVGDAMVHHDDIRVISFTGSNETGRNIA
SECGKQLKKVSLEMGGKNAITVMDDADLNLAVEGIIWSAYGTSGQRCTAASRVIVHEDVK
EKVEERLLVEIEKLAIGDGLDESNKVGPIINKAGLEKIEKYIQIGKEEGAKLMAGGYVLD
DDKYAGGHYYAPTLFTDCTADMRISQEEIFGPVISLIPVKSFEEAIDVNNGVSFGLSSSI
FTTDANRVFQAQRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVQALDVFTEWK
AVYIDYSGKLQRAQIDTE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcactgctgaaaacagacaatctgcaaaattttattgacggtgaatgggtg
gagaagcacgaatcggccccggtgattaatccggcaaacggcaaaacgatcgtggacgtg
cccttatcggatgaaaaagatgtcagtaaagctgttgaagctgcgggaaaagcgcaaaaa
gagtgggcacttgttccggcgccacagcgagctgaagttttgttcaaagccggtcagatg
atgaaagaacggaaagaacggctttcacagcttttgacgatggaaaatggaaaagtgctg
gaagaagcacgaggtgaagttcaggaagggatcgatatggcattttacatggctggcgaa
ggacgccgtctattcggtcacacgacacctgcagagctgccaaataagttttccatgagc
cagcgcgcgccggtaggtgttgtcggcattatcacaccatggaacttcccgattgcaatt
gccacctggaagtcgttcccggcgattgttgcgggcaatgcggttatctggaagccggcg
actgaaacgccaattatggcatatgaactggctaagattcttgaagaagcgggcttgcca
aaaggtatcatgaatgttgtcaatggcagggggtctgctgttggtgatgccatggtgcat
catgacgatatccgggtcatttcatttaccgggtccaatgaaaccggccgcaatatcgca
agcgaatgtggcaaacagctgaagaaagtgtcgctggaaatgggcggcaagaatgcgatt
accgtcatggatgatgctgatctcaatctggcagtggagggcattatttggagtgcttat
ggaacgagcggtcagcggtgtacagcagcgagccgtgtcatcgttcatgaagatgtgaaa
gaaaaggtcgaggagcggttgcttgtcgaaattgaaaaactggcaatcggtgacggactt
gatgaatcaaataaagttggtccaatcattaataaagccggtcttgaaaagatagaaaag
tatattcaaatcggtaaagaggaaggcgccaaattaatggctggcggttatgtgcttgat
gatgataaatatgcaggcggccattattacgcaccaaccttgtttacagactgcacggca
gatatgcgcatctctcaggaagagatattcggtccggttatttcattgattcctgtgaaa
agttttgaagaagcgatcgacgtgaataatggtgtctctttcggtctgtcaagctcgatc
tttacaacagatgccaatagagtttttcaagcacaacgtgatctggataccgggattgtt
tacgtaaacgccggaacgacaggggcagaaatccacctgccatttggcggtacaaaagga
accggaaatggtcatcgcgattcaggtgtgcaggcactcgatgtattcaccgaatggaaa
gctgtttacatcgattacagtggcaaacttcagcgggcacagattgatacggagtaa

DBGET integrated database retrieval system