KEGG   Lentibacillus amyloliquefaciens: AOX59_11450Help
Entry
AOX59_11450       CDS       T04204                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
lao  Lentibacillus amyloliquefaciens
Pathway
lao00473  D-Alanine metabolism
lao01100  Metabolic pathways
lao01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOX59_11450
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AOX59_11450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lao01011]
    AOX59_11450
Enzymes [BR:lao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AOX59_11450
Peptidoglycan biosynthesis and degradation proteins [BR:lao01011]
 Precursor biosynthesis
  Racemase
   AOX59_11450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PKD_3
Motif
Other DBs
NCBI-ProteinID: ALX49145
UniProt: A0A0U4EF18
LinkDB All DBs
Position
complement(2293481..2294602)
Genome map
AA seq 373 aa AA seqDB search
MDSHLFRSTWAEVDLNAIGHNVREMKNRLPEHCAVIAVVKADAYGHGAEKVAEKALDSGA
TMLAVALLKEALVLREANITDPILVFGRVSPHDVPVAASQNIILTCYQKDWVREVNQMKL
PYPVDVHMKWDTGMGRVGLRTEEELIEITDELRNSTAVNLTGVYTHFATADDTEFAYFEK
QQRRFDNVLKTFKSIWAEPVNVHVGNSAASIRFPERMYDYMRFGISMYGLYPSDPVKDER
DIQLKPAFSLHSRLDHVKWLDPGESISYGATYTTEDEEYIGTIPIGYADGWIRKLQGADV
LVDGKRMPIVGRITMDQTMIKLDQAYPVGTQVTLIGKQSDEEIEVDEIAEKLETINYEIP
CMISERVPRQYKS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggacagtcatttatttcggagcacatgggcagaagttgatttgaacgcgattggacat
aacgtcagggaaatgaaaaacagactgcctgagcattgtgctgttattgcggtggttaaa
gcggatgcatatggtcatggagctgagaaagttgctgagaaagcacttgattccggtgca
acgatgctggcagtggcattgctgaaagaagcgcttgttttgcgcgaggcaaatattacg
gatccgattttggtatttggaagagtatcaccgcacgatgtcccggttgctgcgagtcaa
aatattattctgacttgctatcaaaaggattgggttcgtgaagtgaaccagatgaaactt
ccttacccggtagacgtacatatgaaatgggataccggaatgggaagagtcggactcagg
acagaagaagaattaattgaaattactgacgagctccggaacagtacagcagttaatcta
acgggggtctatacacactttgccacagctgatgatactgaatttgcctattttgaaaag
cagcagcgccggtttgacaatgtgcttaagacgtttaaatctatctgggctgagccagta
aacgttcatgttggtaatagtgctgcttcaatccgttttcctgaacgaatgtatgattat
atgcgttttggcatatcgatgtatggtttgtatccgtcagatcctgtaaaagatgaacgc
gatattcaattgaaaccggccttttcattgcatagcagactcgatcatgtgaagtggctc
gacccgggtgaatcgatcagttatggtgcgacttatacgacagaagatgaagagtatatc
gggacaataccgattggttatgctgacggatggatccgcaaattgcagggcgcagacgtg
ttagtcgacggaaaaagaatgccgattgtcggaaggataacgatggatcagacaatgatc
aagctggaccaagcatatccggtggggacacaggttacgctgattggaaaacagagtgat
gaggaaatcgaagtcgatgaaattgctgaaaagcttgagaccatcaactatgaaatacct
tgtatgatatccgaacgtgtgccaagacagtataagtcatag

DBGET integrated database retrieval system