KEGG   Labrenzia sp. CP4: ACP90_00130Help
Entry
ACP90_00130       CDS       T04295                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00290  Valine, leucine and isoleucine biosynthesis
lap00770  Pantothenate and CoA biosynthesis
lap01100  Metabolic pathways
lap01110  Biosynthesis of secondary metabolites
lap01130  Biosynthesis of antibiotics
lap01210  2-Oxocarboxylic acid metabolism
lap01230  Biosynthesis of amino acids
Module
lap_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
lap_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:lap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ACP90_00130
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ACP90_00130
Enzymes [BR:lap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     ACP90_00130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AMN51119
LinkDB All DBs
Position
27067..28866
Genome map
AA seq 599 aa AA seqDB search
MSDTKTPKLRSAAWFDNPDNPGMTALYIERYLNFGITREELQSGKPIIGIAQTGSDLSPC
NRHHLELAKRVREGIREAGGIAFEFPVHPIQETGKRPTATLDRNLAYLGLVELLYGYPID
GVVLTIGCDKTTPACLMAAATVNIPAIALSVGPMLNGWYKGERTGSGTVVWKARQMLAAG
EIDRKGFMDLVASAAPSVGFCNTMGTATTMNSLAEVLGMQLPGAAAIPAPYRERGAISYE
TGKRIVDMVREDLKPSDIMTREAFENAIVVNSAIGGSTNAPIHLNGIARHLGVELDNDDW
QEIGHDVPLLVNLQPAGEYLGEDYFHAGGVPAVVAELMRNGKLPHPGALTVNGKGIGDNC
DGVVTDLPDVIKPFNNPMKDKAGFINLKGNLFDSAIMKTSVISEEFRDRYLSNPDDPEAF
EGRAVVFEGPEDYHDNIDNPDLEIDEHCMLFIRGTGPIGYPGGAEVVNMQPPAALIKRGI
TSLPCIGDGRQSGTSGSPSILNASPEAAAMGGLALLKSGDRVRIDLRKGTADILISDEEL
AQRRTDLEAAGGFKIAESQTPWQEIQRAMIGQFDKGMVLEPAVKYQDVAHTKGLPRDNH
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaccaaaacaccgaaactgcggtccgccgcctggttcgacaatcccgacaat
ccgggcatgaccgcgctctatatcgagcgttacctgaatttcggcatcacacgtgaagag
ctgcagtcgggcaaaccgattatcggcatcgcccagaccgggtctgacctttcgccctgc
aaccgccaccatttggagctggcaaagcgtgtgcgcgaaggtattcgcgaggccggtggt
attgccttcgaatttccggttcacccgatccaggaaaccggcaagcgcccgaccgcgaca
ctggaccggaacctggcctatcttggtctcgttgaactgctgtacggttaccccatcgac
ggcgtggtgctgacaatcggctgcgacaagaccacacctgcctgcctgatggccgccgcg
acggtgaatattccggccatcgcgctgtccgtcggtccgatgctgaacggctggtacaag
ggcgagcgcacgggttccggtaccgtcgtctggaaggcccgccagatgcttgccgcaggc
gagatcgatcgcaagggtttcatggatctcgtcgcctctgcagcgccgtccgtcggcttc
tgcaacaccatgggcacggcgacgaccatgaactcgctggccgaagtcctgggcatgcag
cttccgggggcggccgccattccggcgccctaccgtgagcgcggtgcaatttcctacgag
accggcaaacgcattgtcgacatggtacgcgaggacctgaaaccctccgacatcatgacc
cgcgaagcgtttgagaacgccattgtcgtcaactcggccatcggcggttcgaccaatgca
ccgatccatctgaacggcattgcccgccatctgggtgttgaactggacaacgacgactgg
caggagatcggccatgacgtgccgctgctggtcaatctgcagccggccggagaatatctg
ggcgaggattacttccacgcaggcggcgtgcctgccgtcgtcgcggagctgatgcgaaac
ggcaagctgccgcatccgggcgcgctcaccgtcaacggcaagggcatcggcgacaattgc
gacggtgtcgtcacagacctgccggacgtcatcaagccattcaacaatccgatgaaagac
aaggccggtttcatcaacctgaagggcaacctgttcgacagcgccatcatgaagaccagc
gtcatctcggaagagttccgcgaccgctatctctccaatccggacgatccggaagcgttc
gagggccgtgccgtagtgttcgaagggccggaggattaccacgacaacatcgacaatccg
gaccttgagatcgatgagcactgcatgctgttcattcgcggcaccggcccgatcggttat
ccgggcggtgccgaggtggtcaacatgcagccacccgcagccctgatcaaacgcgggata
acatccctgccctgcatcggcgacggccgtcagtcgggtacatccggttcgccgtcgatc
ctgaacgcatcaccggaagctgccgccatgggcggactcgcgcttttgaaaagcggggac
cgtgtgcgcatcgatctgaggaagggcactgccgacatcctgatttccgatgaggagctt
gcacaacgtcgtacggacctggaggcggcgggcggcttcaagattgcggagagccagaca
ccctggcaggagatccagcgtgcaatgatcgggcagttcgacaagggcatggttctggag
ccggcggttaaataccaggacgtcgcgcataccaaggggctgccacgggacaaccattga

DBGET integrated database retrieval system