KEGG   Labrenzia sp. CP4: ACP90_00765Help
Entry
ACP90_00765       CDS       T04295                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00061  Fatty acid biosynthesis
lap01100  Metabolic pathways
lap01212  Fatty acid metabolism
Module
lap_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ACP90_00765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lap01004]
    ACP90_00765
Enzymes [BR:lap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ACP90_00765
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     ACP90_00765
Lipid biosynthesis proteins [BR:lap01004]
 Fatty acid synthase
  Component type
   ACP90_00765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AMN51228
LinkDB All DBs
Position
161513..162019
Genome map
AA seq 168 aa AA seqDB search
MTDRRSSYDYEALLACGRGELFGPGNAQLPLPPMLMFDRITELSETGGEFDKGFARAEFD
IKPDLWFFPCHFQGNPVMPGCLGLDALWQLTGFFLGWLGLEGKGMALSTGEVKFKGMVTP
DVKLVEYGVDFKRVMKGRLVLGIADGWLKADGEQIYKATDLRVGLAKT
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgccgctccagctacgattatgaagcacttctcgcctgcggccgcggcgag
ctgtttggcccgggcaatgcccagctgcctcttcccccgatgctgatgttcgaccggatc
acggaactttccgaaaccggcggtgaattcgacaaggggttcgctcgcgccgagttcgac
atcaagccggatctctggtttttcccgtgccatttccagggaaatccggtgatgccgggc
tgccttggtctcgacgccctgtggcagctgaccggtttcttccttggctggctgggcctt
gaaggcaagggcatggccctgtcgaccggtgaagtgaagttcaagggcatggttacgccg
gacgtgaagctggtggaatacggtgtcgacttcaagcgggtcatgaagggtcgcctggtt
ctcggcattgccgacggctggttgaaggcggacggtgaacagatttacaaggcgaccgat
ttgcgcgtcggcctggcaaagacctga

DBGET integrated database retrieval system