KEGG   Labrenzia sp. CP4: ACP90_00775Help
Entry
ACP90_00775       CDS       T04295                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00061  Fatty acid biosynthesis
lap00780  Biotin metabolism
lap01100  Metabolic pathways
lap01130  Biosynthesis of antibiotics
lap01212  Fatty acid metabolism
Module
lap_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ACP90_00775
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ACP90_00775
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ACP90_00775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lap01004]
    ACP90_00775
Enzymes [BR:lap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ACP90_00775
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ACP90_00775
Lipid biosynthesis proteins [BR:lap01004]
 Fatty acid synthase
  Component type
   ACP90_00775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AMN51230
LinkDB All DBs
Position
163393..164205
Genome map
AA seq 270 aa AA seqDB search
MSDLMKGKRGLIMGVANDHSIAWGIAKTLADHGAELAFTYQGEAFGRRTKPLADSVGSKI
LVPCDVEDIASVDSVFDTLKEEWGSIDFLVHAIAFSDKTELRGKYADTTRENFSRTMLIS
CFSFTEIAKRAAALMTNGGSMVTLTYGGSTKVMPNYNVMGVAKAALESSVRYLAVDYGEQ
NIRVNAISAGPVRTLAGSGVSDARLMFNFQKRNSPLCRTVSLDEIGGTGLYLLSDLSGGV
TGEVHFVDSGYNIMSMPRLEELKVQEVQAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatctgatgaagggcaaacgcggcctgatcatgggcgttgccaacgaccactcc
attgcctggggtattgccaagacgctcgccgatcacggtgccgaacttgccttcacctat
cagggagaggctttcggccgccgtaccaagccgctggcggattccgtcggttccaagatc
cttgtgccgtgcgacgtggaagacattgcatcggtcgacagcgtgttcgacacgttgaag
gaagagtggggcagcatcgacttcctggtgcatgcgatcgccttttccgacaagacggaa
ctacgcgggaaatacgccgataccacgcgggagaatttctcccgcaccatgctgatctcc
tgcttctccttcaccgaaatcgccaagcgagctgccgctctgatgaccaatggcggttcc
atggtgacgctgacctatggcggttccaccaaggtcatgccgaactacaacgtgatgggc
gttgccaaggctgctctggaatcttccgtccgttacctggcggtggactacggtgagcag
aacatccgcgtgaacgcgatttccgcaggcccggttcggacccttgcaggatccggcgtt
tccgatgcccgcctgatgttcaacttccagaagcgcaattctccgctctgccggaccgtt
tccctggacgaaatcggcggaaccggcctctatctcctgtcggatctttccggtggcgtg
accggtgaagtgcactttgtcgacagtggctacaacatcatgtcgatgccgcgtctggaa
gagctcaaggttcaggaagttcaggccgactga

DBGET integrated database retrieval system