KEGG   Labrenzia sp. CP4: ACP90_07535Help
Entry
ACP90_07535       CDS       T04295                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00240  Pyrimidine metabolism
lap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lap00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ACP90_07535
Enzymes [BR:lap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ACP90_07535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 DUF4192 DUF2075
Motif
Other DBs
NCBI-ProteinID: AMN52311
LinkDB All DBs
Position
complement(1629572..1630150)
Genome map
AA seq 192 aa AA seqDB search
MAKLYFNYSSMNAGKSTVLLQAAYNYEERGMNTLLLIAAFDDRGGKGRIASRIGLGADAD
VFNSADNVFDHILRADEAKKVDAVFVDEAQFLTEDQVWQLARVADTLRIPVMCFGLRTDF
QGKLFPGSAALLALADNLKEIKTICWCGRKATMVARLDADGKIVEEGDQVVIGGNDKYVS
LCRRHWSERKLG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcaactactcctcgatgaacgccggcaagtcgaccgtgctgttg
caggccgcctataactacgaggagcgcgggatgaacacgctgctcctgatcgccgcgttc
gacgaccggggcggaaagggccggatcgcatcgcgtatcgggttgggagcggatgccgat
gtcttcaactcggctgacaacgtctttgatcacatactgcgcgccgacgaagcgaagaag
gtcgacgcggtcttcgtcgatgaagcccagtttctgacggaagaccaggtctggcagctc
gcccgggtggccgacacgctgcgcattccggtgatgtgcttcggcctcagaacggatttc
cagggaaagctcttccccggcagcgccgccttgctggcgcttgcggataatctgaaggaa
atcaagaccatctgctggtgcggacgcaaggcaaccatggttgcccggttggatgcggac
ggcaagatcgtcgaggaaggcgaccaggtcgttattggtggcaatgacaagtatgtctcg
ctctgccgccgtcactggagcgagcggaagctgggctga

DBGET integrated database retrieval system