KEGG   Labrenzia sp. CP4: ACP90_13325Help
Entry
ACP90_13325       CDS       T04295                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACP90_13325
Enzymes [BR:lap01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ACP90_13325
Transporters [BR:lap02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACP90_13325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AMN53252
LinkDB All DBs
Position
2840915..2841565
Genome map
AA seq 216 aa AA seqDB search
MADQVELFYAPQTRATGVRVLLEELGAPYKLNVLNLKLGENRTPRYLAVNPAGKVPALRV
GEAVITEQVAIYIYLADLFPEKGLTPSLDDPLRGPYLRWFVHMASCFEPALIDRALKREE
PPHSMSAYGSFDTVMESMRAQLAKGPFVLGERMTAVDVLWGMGLRWGTMFGIVPEFEEFT
AYIERFAERPSVVKVLQEDQNMAREQEDAAVQAGVA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaggtcgaactcttttatgcacctcagacacgcgccaccggcgtacgtgtt
ctcctggaggagctgggcgcaccttacaagttgaatgtgctcaatctgaagctgggtgaa
aaccggacaccccgatatcttgccgtcaacccggctggcaaagttccggcattgcgcgtt
ggcgaggcagtcattaccgaacaggtcgcgatctatatctatctggccgacctgtttcct
gaaaaaggactgacaccctcgctggatgatccactgcgtggaccgtacctgcgatggttc
gtgcatatggcatcctgttttgagccggcactgattgaccgcgcactcaagcgtgaagaa
ccgccgcattccatgtccgcctatggttcttttgacaccgtcatggaaagcatgcgtgcc
cagctggcaaagggacctttcgttcttggagaacggatgacggctgtcgacgttctgtgg
ggaatggggctgcggtggggaacaatgttcggcatcgtaccggaattcgaagaattcacc
gcctacatcgagcggttcgccgaaaggccgtcggtggtcaaggtgctgcaggaagaccag
aacatggccagggagcaggaagacgctgctgttcaggcgggtgtcgcgtaa

DBGET integrated database retrieval system