KEGG   Labrenzia sp. CP4: ACP90_14525Help
Entry
ACP90_14525       CDS       T04295                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lap  Labrenzia sp. CP4
Pathway
lap00473  D-Alanine metabolism
lap00550  Peptidoglycan biosynthesis
lap01100  Metabolic pathways
lap01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lap00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ACP90_14525
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACP90_14525
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ACP90_14525
Enzymes [BR:lap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ACP90_14525
Peptidoglycan biosynthesis and degradation proteins [BR:lap01011]
 Precursor biosynthesis
  Amino acid ligase
   ACP90_14525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: AMN55925
LinkDB All DBs
Position
complement(3115901..3116977)
Genome map
AA seq 358 aa AA seqDB search
MAHLSQKLSVAILFGGRSAEHEVSVLSATNVMNALDPSKYDAVPVYVTREGQWLLSNFEN
GHLARPTTGIEICPVPGGRGRVIALDENGLPRDFDKLDAVFPVLHGLHGEDGAVQGLAEV
ARVPLVGCGIAGSANALDKDLAKRLLIEAGLPTAKSLTIRPDDVPDFERLKRELGLPVFI
KPARQGSSVGVSKVQTADDFEAALKEGFKHDNKLLAEEFVLGREIEFAVLEESDGTLFVS
RPGEIVPAESHGFYTYDAKYVDEDGAALKVPADLPHEVEGRMQDLAAKAFRALGCDGMAR
VDFFVTQEMNFLLNELNTIPGFTNISMYSKAMAASGVSYPEIIDRLITHGITRAERDI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttggcacatctttctcaaaaactgagtgtagccatcctgtttggcgggcgatctgcggaa
cacgaagtctcggtcctttccgccacaaatgtcatgaacgcgctcgatccttccaagtat
gacgcggttccggtctacgtcacccgtgaaggacaatggctgctgagcaattttgagaat
gggcatctggcacggccgacaactggcattgaaatctgtcctgttccaggtggccgtggc
cgagtgattgcactggatgaaaacgggttgcctcgtgactttgacaagctcgacgcggtc
tttcccgtgcttcatggcctccatggcgaagatggtgcggtgcagggactagctgaagtg
gcccgggttccgctcgttggatgcggtatcgcagggtctgcaaatgcactcgataaggat
cttgcaaaacggcttctcatcgaggccggcctccccacggccaaatcactcacaattcgg
ccggacgatgtgccggacttcgaacgcctgaagcgcgaacttggtttgcccgtattcatc
aaacctgcccgccagggttcctcggtcggtgtcagcaaggttcagacggcagacgacttt
gaggccgccttgaaagaagggttcaagcacgacaacaagcttcttgccgaggagttcgtt
cttggccgcgaaatcgaattcgcggtcctggaggaaagcgacggcacgctgttcgtctcc
aggccgggcgaaatcgttcctgccgaaagccatggcttttacacctatgacgcaaaatat
gtcgacgaagacggcgcggccttgaaggtgcccgcagatttgccgcacgaggtcgaaggc
cggatgcaggatctggcggcaaaagcgttcagagccctgggatgcgacggcatggctcgt
gtcgatttctttgtgacgcaggaaatgaatttcctgctgaacgaactaaacacgatcccc
ggctttacgaatatcagcatgtattccaaagcgatggctgcaagcggcgtcagctatccg
gagatcatcgatcgtctgatcacccacggcattacccgggcagaacgggatatctga

DBGET integrated database retrieval system