KEGG   Labrenzia sp. CP4: ACP90_25475
Entry
ACP90_25475       CDS       T04295                                 

Definition
(GenBank) histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
lap  Labrenzia sp. CP4
Pathway
lap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lap00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACP90_25475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lap01001]
    ACP90_25475
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lap02022]
    ACP90_25475
Enzymes [BR:lap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ACP90_25475
Protein kinases [BR:lap01001]
 Histidine kinases
  OmpR family
   ACP90_25475
Two-component system [BR:lap02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   ACP90_25475
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_2 DUF2730 HATPase_c_3 DUF677
Other DBs
NCBI-ProteinID: AMN56273
LinkDB
Position
complement(5539169..5540956)
AA seq 595 aa
MGASEPQNGSDRSRLRRLGNKRIRRRLLSQLGRIFGTYVLSSLTRRIIAINLVGLLALVI
GILYLNQFRAGLIDARVQSLLTQGEIIAGAIAASATVDTGTITVDPERLLQLQAGESITP
TQEDLDSLDFPINPERVGPVLRRLISPTKTRARIYDPEGILILDSRHLYTSAQILRFDLP
PPTAEEEGFWDSTWQWIKRWLRQGDLPIYQDVGGGDGRAYPEVEAALAGSPASVTRISQR
GELIVSVAVPIQRFRAVLGALLLSTQGGDIDAIVRAERIAIIRVFLFAATVTILLSILLA
GTIAGPVRRLAAAADRVRRGSTSREEIPDFSDRQDEIGHLARSFREMTHALYNKIDAIEQ
FAADVAHELKNPLTSLRSAVETLPLAKSKNSQDRLMEVIQHDVRRLDRLISDISDASRLD
AELARIQAEPIDLAELLRNMADAANQRSGAEEASVKLAVADAQGSKPYQMQGHDIRLGQV
VSNLLDNARSFSPAGGTVRVDLSRDGRMIKIIVDDDGPGIRAENTERIFERFYTDRPEGE
GFGNNSGLGLSISRQIIEAHGGTIVATNRLVPGRDGKQKIAGARFTIYLPAGRSK
NT seq 1788 nt   +upstreamnt  +downstreamnt
attggtgcctctgaacctcagaacggttcggatcgctcccgtctgcgccgacttggcaac
aagcggatccgtcgccgtctgctcagccagttgggccgtatcttcggaacctatgttctc
tcgtcgctgacgcgccggatcatcgccatcaacctcgtgggtctgctggcactggtgatc
ggtattctgtacctcaaccagtttcgcgcgggtctgatcgatgcacgggtgcagagcctt
ctgacccagggcgaaatcattgccggcgccattgccgcttccgccaccgtcgatacgggc
acgatcaccgtcgaccccgaacgcttgttgcagttgcaggcgggcgaaagcattaccccg
acccaggaagacctcgacagtctcgattttccgatcaacccggaacgggtcggtcccgtg
ctgcgccgcctgatttcgccgaccaagacccgggcgcggatctatgatccggaaggcatt
ctcatcctcgacagccgccacctttataccagtgcccagatcctgcgcttcgatctgccg
cctccgacggcggaggaggaaggcttctgggattcgacctggcaatggatcaagcgctgg
ctgcgccagggtgacctgccgatctatcaggacgtaggcggcggtgatggccgcgcctat
ccggaagtggaggcggcgcttgccgggtccccggccagcgtgacgcggatctcgcaacgg
ggcgagctgatcgtttccgttgccgtgccgatccagcggttccgcgcggtcctcggggcc
ttgctcctgtcgacacagggcggtgacatcgacgccatcgtgcgggctgaacgtatcgcc
atcattcgcgtgttcctgtttgccgccacagtgaccatccttctgtcgatcctgctggcc
gggacgattgccggcccggtccggcgccttgcggctgccgcggaccgggtgcggagaggc
tcgacctctcgtgaggagataccggacttttcggatcggcaggacgagatcggccatctg
gcgcgttcgttccgggaaatgacccacgcgctctacaacaagatcgatgcgatcgagcag
tttgccgccgatgtcgcgcacgaattgaagaacccgctgacatcgctgcgcagtgccgtg
gaaaccctgccgctggccaagtccaagaattcgcaggaccggttgatggaagtgatccag
catgacgtgcgccgcctcgatcgtctgatcagtgacatctccgatgcttcccgccttgat
gcggaactggcccggatccaggccgagccgatcgacctggccgaactgctgcgcaacatg
gccgatgccgccaaccagcggtccggagcggaagaggcaagtgtcaagctggccgttgca
gatgctcagggcagcaagccttatcagatgcaaggccatgatattcgtctcggacaggtc
gtcagcaaccttctggacaacgccaggtccttctcgcccgccggcggaacggttcgggtg
gatctcagtcgggacggccggatgatcaagatcatcgtggatgatgacggtccgggcatc
cgtgctgaaaacaccgagcgcatttttgaacgcttctataccgacaggccggaaggcgaa
ggcttcggcaacaattccggtctgggtctgtcgatctcccggcagatcatcgaagcccat
ggcgggaccatcgttgccaccaaccggctggtgcccggtcgggacggcaagcagaagatt
gcaggtgctcgtttcaccatctatctgccggcagggcggagcaagtga

DBGET integrated database retrieval system