KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_1975Help
Entry
GLA29479_1975     CDS       T04526                                 

Gene name
cobT
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq00860  Porphyrin and chlorophyll metabolism
laq01100  Metabolic pathways
Module
laq_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:laq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GLA29479_1975 (cobT)
Enzymes [BR:laq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     GLA29479_1975 (cobT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: ALN62847
LinkDB All DBs
Position
complement(2160960..2162027)
Genome map
AA seq 355 aa AA seqDB search
MNDESKWWLRGCARPDTAIETQARTRQTQLTKPPGSLGLLEELAIRLAALQRTPAPKVDR
VWISVFAADHGVAAEGVSAFPQAVTGEMVRNFAHGGAAISVLARSLGATLDVVNLGTVND
PGPIRGVHRAIIAESTANFCEAPAMSEAQLRAALGAGAASVRAALDGAAQLFIGGEMGIA
NTTSASALASALLDRSPAELSGAGTGLDADGIAHKVGVIERALARHAGAGDAWERLRCLG
GFEIAALAGAYIAAAQAGLPVLVDGFIASVSALVAQAINPSCREWFLYAHRSHERGHAAV
LQALGAQPLLDLGMRLGEASGAAVAVPLLRSACALHNGMATFAQAGVSEAASQQA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgacgaaagcaaatggtggctgcgcggttgcgcacgcccggacaccgccatcgaa
acccaggcgcgcacgcgccagactcagctaaccaaaccgccgggctcgctcggcctgctc
gaggagctcgcgatacgcctggcggccttgcaacgcacgccggcgccgaaggtcgaccgg
gtctggatcagtgtgttcgccgccgatcacggcgtcgccgccgaaggcgtgtcggcgttc
ccgcaggcggtcaccggcgagatggtgcgcaacttcgcccacggcggcgccgcgatcagc
gtgctcgcgcgcagcctcggcgcgaccctggacgtggtcaacctcggcacggtcaatgac
cccggcccgatccgcggcgtgcatcgcgcgatcatcgccgagagcacggccaacttctgc
gaagcgccggcgatgagcgaagcgcagctgcgcgcggccctgggcgccggcgccgccagc
gtgcgcgccgcgctcgatggcgcggcgcagttgttcatcggcggcgagatgggcatcgcc
aacaccacctcggcctcggccttggcgagcgccttgctcgatcgttcgccggccgagctg
agcggcgccggcaccggcctggatgccgacggcatcgcccacaaggtcggcgtgatcgaa
cgcgcactggcgcggcacgccggcgccggcgacgcctgggagcgcctgcgttgcctcggc
ggtttcgagatcgccgcgctggcgggcgcctacatcgccgcggcccaggccgggctgccg
gtgctggtcgacggtttcatcgccagcgtgtccgcgctcgtcgcccaggccatcaacccg
agctgccgcgaatggttcctgtatgcgcaccgctcgcacgaacgcggtcacgccgcggtg
ttgcaggcgctcggcgcgcagcccttgctcgacctcggcatgcgcctgggcgaggccagc
ggcgccgcggtcgctgtgccgttgttgcgctcggcctgtgccctgcacaacggcatggcc
accttcgcccaggcgggagtgtccgaggcggcctcgcaacaggcatga

DBGET integrated database retrieval system