KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_3027Help
Entry
GLA29479_3027     CDS       T04526                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase dacC
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq00550  Peptidoglycan biosynthesis
laq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GLA29479_3027 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:laq01002]
    GLA29479_3027 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:laq01011]
    GLA29479_3027 (dacC)
Enzymes [BR:laq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     GLA29479_3027 (dacC)
Peptidases [BR:laq01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   GLA29479_3027 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:laq01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   GLA29479_3027 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ALN63890
LinkDB All DBs
Position
3329839..3330882
Genome map
AA seq 347 aa AA seqDB search
MDAASGNILASKDADVRVEPASITKVMTSYVIAAEMAGGKVKDTDQVMMTENAWRKGGAA
TDGSYSGFEVNKTAALVDMEKGMVVQSGNDAAIALAEHVAGSEDAFAALMNQYAARIGLK
GSHFVNPHGLSDPNHYSTAHDLALLGRALIRDFPVAYSYNKIKELKVGPITQPNRNLLLW
RDSTVDGIKTGHHSKAGYCLMASAQRGDQRLISVVMGSTSEAQRATDSQALLNWGFRFYE
THKLYDIGKVIAKQKVWKGQADEVQFGVAEPMLVSVPRGKYAQLKPSIDVPKTLVAPIKK
GQALGTVKVMLDGKVVAQRPLVAIAAVEEGGFFKRLWDEFWMWWESE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatgccgccagcggcaacatcctggccagcaaggacgccgacgtgcgggtcgagccg
gccagcatcaccaaggtcatgaccagctacgtgatcgccgccgaaatggccggcggcaag
gtcaaggacaccgatcaggtgatgatgaccgagaacgcctggcgcaagggcggcgcggcc
accgacggcagctactccggtttcgaggtcaacaagaccgcggcgctggtcgacatggaa
aagggcatggtggtgcagtccggcaacgacgccgcgatcgccctggccgaacacgtcgcc
ggcagcgaagacgccttcgccgcgctgatgaaccagtacgccgcgcgcatcggcctgaag
ggctcgcacttcgtcaatccgcacggcctgtcggacccgaatcattactcgaccgcgcac
gacctggccctgctcggccgcgccctgatccgcgacttcccggtcgcgtattcgtacaac
aagatcaaggaactcaaggtcgggccgatcacccagcccaaccgcaacctgctgctgtgg
cgcgattccacggtcgacggcatcaagaccggtcaccactccaaggccggttactgcctg
atggcctcggcccagcgcggcgaccagcgcctgatctcggtggtgatgggctcgacctcc
gaagcgcagcgcgcgaccgacagccaggcgctgctcaactggggcttccgtttctacgaa
acccacaagctttacgacatcggcaaggtgatcgccaagcagaaggtgtggaagggccag
gccgacgaagtgcagttcggcgtcgccgagccgatgctggtcagcgtgccgcgcggcaag
tacgcccagctcaagcccagcatcgacgtgcccaagacgttggtcgcgccgatcaagaag
ggccaggccctcggtacggtcaaggtcatgctcgacggcaaggtcgtcgcccagcgcccg
ttggtcgccatcgccgcggtcgaggaaggcggtttcttcaagcgcctgtgggacgagttc
tggatgtggtgggagtcggagtga

DBGET integrated database retrieval system