KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_3474Help
Entry
GLA29479_3474     CDS       T04526                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq00564  Glycerophospholipid metabolism
laq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:laq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GLA29479_3474
Enzymes [BR:laq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GLA29479_3474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 FAD_binding_2 GIDA
Motif
Other DBs
NCBI-ProteinID: ALN64327
LinkDB All DBs
Position
3790054..3791589
Genome map
AA seq 511 aa AA seqDB search
MSLPDVDLLVVGGGINGVAIARDAAGRGLSVLLCERDDIASHTSSASTKLIHGGLRYLEQ
FEFALVGKALAERKRLLRMAPHIIWPLRFVLPHQPHLRPAWMIRIGLFLYDRLGGRRGRG
LPGSRSVNLRKHITGRPLRDDFIHGFVYSDAWVQDARLAVLNAMDAAERGATVLTRTACV
SARRGEQAWDVRLRGADGVSRQVRARVLINATGPWAVRFLDQVAQVPHRHSLRLIKGSHI
VVPRLFEHDHAYIFQQPDRRIVFAIPYEHDYTLIGTTDVDYRADPSAPHIDEAETQYLCE
AASRYFKRAIQASDVVWTYSGVRPLLDDESDAASEITRDYLLTLDREGAPLLNVFGGKLT
TARKLAEEACDRLAPLFGGLRPAWTGTAPLPGGDLPDADFDAFHEDFSLRRPWLPDALAL
RLCRNYGSRALRIVESCSHLQDLGECLGADLYTAEVDYLVDSEWARSADDILWRRSKLGL
RIDAAGAMQLQGYVALRVAGRVDRDAPAGHA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttgcccgatgtcgacctgctcgtcgtcggcggcggcatcaacggcgtcgccatc
gcccgcgacgccgccggccgcggcttgtcggtgctgctgtgcgaacgcgacgacatcgcc
tcgcacacctccagcgccagcaccaagctgatccacggcggcctgcgctatctcgaacag
ttcgagttcgccctggtcggcaaggccctggccgaacgcaagcgcctgttgcgcatggcc
ccgcacatcatctggccgctgcgtttcgtcctgccgcatcaaccgcatctgcgcccggcg
tggatgatccgcatcggcctgttcctgtacgaccggctcggcggccggcgcggacgcgga
ctgcccggttcgcgctcggtcaacctgcgcaagcacatcaccgggcggccgttgcgcgac
gacttcatccacggcttcgtctactccgacgcctgggtccaggacgcgcgcctggcggtg
ctcaacgcgatggatgcggccgagcgcggcgcgaccgtgctgacccgcaccgcctgcgtc
tcggcgcggcgtggagaacaggcttgggacgtacgcttgcgcggcgccgacggcgtgtcg
cggcaagtgcgcgcgcgtgtcctgatcaatgccaccggtccgtgggcggtacgcttcctc
gaccaagtcgcgcaggtgccgcaccggcacagcctgcgcctgatcaagggcagccacatc
gtcgtgccgcggttgttcgagcacgatcatgcctacatcttccagcaacccgatcgccgc
atcgtgttcgcgatcccgtacgagcacgactacaccctgatcggcaccaccgatgtcgac
taccgcgccgacccttcggcgccgcacatcgacgaggccgaaacccagtacctgtgcgag
gccgcctcgcgctatttcaagcgcgccatccaagcgagcgacgtggtctggacctacagc
ggcgtgcggcccctgctcgacgacgaaagcgacgccgcatcggaaatcacccgcgattac
ctgctcaccctcgaccgcgaaggcgcgccgctgctcaacgtgttcggcggcaagctaacc
accgcgcgcaagctggccgaggaagcctgcgaccggctcgcaccgctgttcggcggactg
cgcccggcctggaccggcaccgcaccgttgccgggcggcgatctgcccgatgccgatttc
gacgccttccatgaagacttcagcctgcgccggccgtggctgccggacgcgctggccctg
cgcctgtgccgcaactacggcagccgggcgctgcgcatcgtcgagagctgctcgcatctg
caggacctgggcgaatgtttgggcgccgacctgtacacggccgaggtcgattacctggtc
gattccgagtgggcgcgcagcgccgacgacattctgtggcggcgctcgaagctcgggctg
cgcatcgatgcagccggcgcgatgcaactgcaggggtatgtcgcgctacgcgtggccggt
cgagtcgatagagatgcaccagcggggcacgcatga

DBGET integrated database retrieval system