KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_4150Help
Entry
GLA29479_4150     CDS       T04526                                 

Gene name
ung
Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:laq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GLA29479_4150 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:laq03400]
    GLA29479_4150 (ung)
Enzymes [BR:laq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     GLA29479_4150 (ung)
DNA repair and recombination proteins [BR:laq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     GLA29479_4150 (ung)
 Prokaryotic type
     GLA29479_4150 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ALN64996
LinkDB All DBs
Position
complement(4515375..4516079)
Genome map
AA seq 234 aa AA seqDB search
MNDVDREPKLDASWKARVGDWFAREDMQSLSRFLRERKAAGARIFPPGPQIFSAFDATPF
EQVKVVILGQDPYHGYGQAHGLCFSVQPGVPVPPSLDNIFKEIQRDLGIARPDHGCLLPW
AQRGVLLLNAVLTVEEGRAGAHQGKGWEGFTDHVVDTLNREREGLVFLLWGSYAQAKGKV
IDAGRHRVLKAPHPSPLSAHRGFIGCGHFSTANEYLSRHGKGPIDWTLPARDAL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtcgatcgcgagcccaagctcgacgcctcctggaaagcccgcgtcggcgac
tggttcgcgcgcgaggacatgcagtcgctgtcgcgcttcctgcgcgagcgcaaggcggcc
ggcgcgcgcatcttcccgcccggcccgcagatcttctcggccttcgacgccaccccgttc
gagcaggtcaaggtcgtcatcctcggccaggacccgtaccacggttacggccaggcgcac
gggctgtgtttctcggtccagcccggcgtgccggtgccgccgtcgctcgacaacatcttc
aaggaaatccagcgcgacctcggcatcgcccggcccgatcacggctgcctgctgccgtgg
gcgcaacgcggcgtgctgctgctcaacgccgtgctgacggtcgaggaaggccgcgccggc
gcgcatcagggcaagggctgggaaggtttcaccgaccacgtcgtcgacaccctcaatcgc
gaacgcgagggcctggtgttcctgctgtggggcagctacgcccaggccaagggcaaggtc
atcgacgccggccgccatcgcgtgctgaaggcgccgcatccctcgcccttgtcggcgcac
cgcggcttcatcggctgcgggcatttctccaccgccaacgagtacctgtcgcgccacggc
aagggcccgatcgattggactttgccggcgcgcgatgcgctttga

DBGET integrated database retrieval system