KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_4163Help
Entry
GLA29479_4163     CDS       T04526                                 

Definition
(GenBank) penicillin-binding, 1A family protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq00550  Peptidoglycan biosynthesis
laq01100  Metabolic pathways
laq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:laq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GLA29479_4163
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    GLA29479_4163
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:laq01003]
    GLA29479_4163
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:laq01011]
    GLA29479_4163
Enzymes [BR:laq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     GLA29479_4163
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     GLA29479_4163
Glycosyltransferases [BR:laq01003]
 Polysaccharide
  Bacterial polysaccharide
   GLA29479_4163
Peptidoglycan biosynthesis and degradation proteins [BR:laq01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   GLA29479_4163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ALN65009
LinkDB All DBs
Position
4527388..4529970
Genome map
AA seq 860 aa AA seqDB search
MSRIRRWLRWALYAFIGAVLLGAIALGTLYYLIVPKLPDVETLRTVELQEPMYVYARDGR
LMALFGETRRYPIAIEDVPDRLKQAFIAIEDARFYKHHGIDYKGIGRAIWLLATTDDKRV
PGGSTITQQVARQFFLSSEYSYKRKLGEMLLAMRMERELSKDEIFELYLNKSFFGNRAYG
VGAAAEFYYGKKMSELSLDEMASLAGIPKFPSSGNPLSNPDRAKLRRDYILDRMAEQRFI
SADEAAQAKAVPMHASPHERPVEVYAPYVAEMVRQEMIARYGAEALTKGYHVTTTIDPTL
QVAADKAVRDGLSVYDRRHGWHGVEQHFDLAAGEDAATARQRLRGIPAQANLLPAVVLGN
SGGQANVVLGDGTELTLTEKQGFGGRSPGSLVKRGDVVRIQRTETVTEPVVAPAAPAGTA
AAVVPAVPAKPPVVSYRLDQLPQAQAALVSLEPSNGALRALSGGYSFAGAKFNRATQARR
QPGSSFKPFVYAAAFERGYNPASIVLDAPVVFKDRRGHLWRPQNDGGNFAGPMRVREAMV
QSRNLVSVRLLDAMGVDFARKYISHFGFDPEQLPPNLSMSLGTASLTPLSVARGYSVFAN
GGFRITPWFIDEVKDRAGAVVFKEKPATACPECGGRGGTSVAVPVSTVVDGFDLGPAGGS
ADTAKPDPKKPDPKAKKADDKPAAPKKELTAAEKASMNLAPRAIDDRIAYQIVSMLRDVV
KRGTGTAAKVLGREDVGGKTGSTNDHRDAWFSGFGGPYVTTVWVGRDNYKSLGYREYGGK
AALPIWIDYMRVALKDQPLAVNEPPQGMVKVSVAGNGALIPDGAGGVIEWVKAEDLERMQ
TYTDYGNEESAPSEESYDIF
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattcgccgttggctgcgttgggcgctctatgcgttcatcggcgcagtcctg
ctgggcgccatcgcgctcggcaccctgtactacctgatcgtccccaagcttcccgacgtc
gagaccctgcgcacggtcgagctgcaggaaccgatgtacgtctatgcccgcgacggccgc
ctgatggcgctgttcggcgagacccggcgctacccgatcgccatcgaggacgtgcccgac
cggctcaagcaggcgttcatcgcgatcgaggacgcccgtttctacaagcaccacggcatc
gactacaagggcatcggccgggcgatctggctgctggcgaccaccgacgacaagcgcgtc
cccggcggctcgaccatcacccagcaggtcgcgcgccagttcttcctgagctcggaatac
agctacaagcgcaagctcggcgagatgctgctggcgatgcgcatggagcgcgagctcagc
aaggacgagatcttcgagctgtacttgaacaagagcttcttcggcaaccgcgcctacggc
gtcggcgccgccgccgagttctactacggcaagaagatgagcgagctctcgctcgacgag
atggcctcgctcgcgggcattccgaaattcccgtccagcggcaacccgctcagcaatccc
gaccgcgccaagctgcgccgcgactacatcctcgaccgcatggccgagcagcgtttcatc
agcgccgacgaagccgcgcaggccaaggcggtgccgatgcacgccagcccgcacgagcgc
ccggtcgaggtctacgcgccctacgtggccgagatggtgcgccaggaaatgatcgcccgt
tacggcgccgaggcgctgaccaagggctatcacgtcaccaccaccatcgaccccaccctg
caggtcgcggccgacaaggcggtgcgcgacgggctctcggtctacgaccgccgccacggc
tggcacggggtcgagcagcacttcgacctcgccgccggcgaggacgccgcgaccgcgcgc
cagcgcctgcgcggcatcccggcccaggccaacctgttgcccgcggtcgtgctcggcaac
agcggcggccaggccaatgtcgtgctcggcgacggcaccgagctgacccttaccgaaaag
cagggcttcggcggccgcagccccggcagcctggtcaagcgcggcgacgtggtgcgcatc
cagcgcaccgagaccgtgaccgagccggtggtcgctccggcggctccggccggcactgcg
gcagcggtcgtgccggccgtgccggccaaaccgccggtggtgagctaccgcctcgaccaa
ctgccgcaggcacaggccgcgctggtgtcgctggaaccgagcaacggcgccttgcgcgcg
ctgtccggtggttacagttttgccggcgccaagttcaaccgcgccacccaggcgcgccgc
cagcccggctcgagcttcaagccgttcgtatacgcggccgcgttcgagcgcggctacaac
ccggcctcgatcgttctcgacgccccggtggtgttcaaggaccgccgcggccatctgtgg
cgtccgcagaacgacggcggtaacttcgccggcccgatgcgcgtgcgcgaagcgatggtg
cagtcgcgcaacctggtctcggtgcgcctgctcgacgccatgggcgtcgatttcgcccgc
aagtacatcagccacttcggcttcgacccggagcagctgccgccgaacctgtcgatgtcg
ctcggcaccgcctcgctgacgccgctgtcggtcgcacgaggctattcggtgttcgccaac
ggcggtttccgcatcactccgtggttcatcgacgaggtcaaggatcgcgccggcgccgtg
gtgttcaaggaaaagccggccaccgcctgccccgaatgcggcggccgcggcggcacctcg
gtcgccgtgccggtcagcaccgtcgtcgacggtttcgacctgggcccggccggcggcagc
gccgacacggccaagcccgacccgaagaagcccgatccgaaggcgaagaaggccgatgac
aagccggccgcgccgaagaaggaactgactgcggccgagaaggcaagcatgaacctggcg
ccgcgcgcgatcgacgaccgcatcgcctaccagatcgtttcgatgctgcgcgacgtggtc
aagcgcggcaccggcaccgcggccaaggtgctcggccgcgaggacgtcggcggcaagacc
ggctcgaccaacgaccatcgcgacgcctggttctccggcttcggcgggccttacgtcacc
acggtctgggtcggccgcgacaactacaagtcgctgggttaccgcgaatacggcggcaag
gccgccctgccgatctggatcgactacatgcgcgtcgcgctgaaggaccagccgctcgcc
gtcaacgagccgccgcagggcatggtcaaggtgtccgtcgccggcaacggcgcgctgatt
cccgacggcgccggcggcgtgattgagtgggtcaaggccgaagacctcgaacgcatgcag
acctataccgattacggcaacgaagaatcggcgccgtcggaagagtcctacgacatcttc
tga

DBGET integrated database retrieval system