KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_4890Help
Entry
GLA29479_4890     CDS       T04526                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq00071  Fatty acid degradation
laq00280  Valine, leucine and isoleucine degradation
laq00281  Geraniol degradation
laq00310  Lysine degradation
laq00362  Benzoate degradation
laq00380  Tryptophan metabolism
laq00410  beta-Alanine metabolism
laq00640  Propanoate metabolism
laq00650  Butanoate metabolism
laq00903  Limonene and pinene degradation
laq00930  Caprolactam degradation
laq01100  Metabolic pathways
laq01110  Biosynthesis of secondary metabolites
laq01120  Microbial metabolism in diverse environments
laq01130  Biosynthesis of antibiotics
laq01200  Carbon metabolism
laq01212  Fatty acid metabolism
Module
laq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:laq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GLA29479_4890
   00650 Butanoate metabolism
    GLA29479_4890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GLA29479_4890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GLA29479_4890
   00310 Lysine degradation
    GLA29479_4890
   00380 Tryptophan metabolism
    GLA29479_4890
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GLA29479_4890
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GLA29479_4890
   00281 Geraniol degradation
    GLA29479_4890
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GLA29479_4890
   00930 Caprolactam degradation
    GLA29479_4890
Enzymes [BR:laq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GLA29479_4890
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GLA29479_4890
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     GLA29479_4890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Pyr_redox_2 DAO ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ALN65715
LinkDB All DBs
Position
5376706..5378775
Genome map
AA seq 689 aa AA seqDB search
MTAALDGLPAFDGLRARHWHTELREDGVLVLSFDREGSPVNTFAQEVLIELDGLLERLAL
DPPKGLVLRSAKSSGFVAGADIKEFQSFDEKGTVGDAIRRGQQVFQRLAELPCPTVAAIH
GFCMGGGTEIALACRYRVASSDASTRIGLPEVKLGIYPGWGGSVRLPPLVGAPAAFDMML
TGRTLSASAARAIGLVDKIAEPAVLVDTAAGIALRGAERPFKQRFMGWASNTWPARKILA
PMLVKQVARKARKDHYPAPYALISTWERTGGGVQAKLAAERKSVVKLSSTPTARNLIRVF
FLQERLKGQGGKEHGIKHVHVVGAGVMGGDIAAWSAYKGFEVTLSDREQRFIDGALERAQ
ELFAKKVKDEAKRPAVAARLKGDLGGEGADLADLVIEAIIEKPEAKRELYDQVEPRMKSD
ALLTTNTSSIPLDELREHIRRPAQFGGLHYFNPVALMPLVEIIRHDRMAPETEQRLAAFC
KAIDKLPVPVAGTPGFLVNRVLFPYMLEAGTAFAEGIPGPAIDKAAVKFGMPMGPIELID
TVGLDVAAGVGAELAPFLGLTVPSALSNVEPGKRGKKDGQGLYKWENGRAQKPELSKDYK
APNDLEDRLILPLINEAVACLHDGVVSDGDLLDAGVIFGTGFAPFRGGPIQYVRENGPDA
VLARLKQLQARYGDRFAPRPGWDSPLLRK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagccctcgacggcctccccgcttttgacgggctccgcgcccgccattggcac
accgaattgcgcgaggacggcgtactggtgctctcgttcgaccgcgaaggatcgccggtc
aacaccttcgcccaggaagtgctgatcgaactcgacggcctgctggagcgcctcgccctg
gacccgcccaagggcctggtgctgcgctcggccaagagcagcggcttcgtcgccggcgcc
gacatcaaggaattccagagcttcgacgagaaaggcacggtcggcgacgccatccgtcgc
ggccaacaggtgttccagcgcctggccgaactgccctgccccacggtcgcggccatccat
ggcttctgcatgggcggcggcaccgagatcgccctggcctgccgttaccgcgtcgccagc
agcgatgcctcgacccggatcggcctgccggaagtgaagctcggcatctacccgggctgg
ggcggcagcgtgcgcctgccgccgctggtcggcgcgccggccgcgttcgacatgatgctg
accggacgcaccctgtcggcctcggccgcgcgcgcaatcggcctggtcgacaagatcgcc
gagcccgcggtactggtcgacactgccgccggcatcgccctgcgcggcgccgaacgtccg
ttcaagcagcgcttcatgggctgggccagtaacacctggccggcgcgcaagatcctcgcg
ccgatgctggtcaagcaggtcgcccgcaaagcgcgcaaggaccactaccccgcaccctac
gccctgatctccacctgggagcggaccggcggcggcgtacaggccaagctcgccgccgaa
cgcaagtcggtggtcaagctgtcgtccaccccgaccgcacgcaacctgatccgggtgttc
ttcctgcaggaacggctcaagggccagggcggcaaggagcacggcatcaagcacgtgcac
gtggtcggcgccggcgtgatgggcggcgacatcgcggcgtggtcggcctacaagggcttc
gaggtcacgctgtccgatcgcgaacagcgcttcatcgacggcgcgctcgaacgcgcacag
gaactgttcgccaagaaggtcaaggacgaggccaagcgcccggccgtggccgcacgcctc
aaaggcgatctgggcggcgaaggcgccgatcttgccgacctggtgatcgaggcgatcatc
gagaagcccgaagccaagcgcgagttgtacgaccaggtcgagccgcgcatgaaatccgat
gcgctgctgaccaccaacacctcgtcgatcccgctcgacgaactgcgcgaacacatccgc
cgcccggcccagttcggcggcctgcattacttcaacccggtcgccttgatgccgctggtg
gaaatcatccgccacgaccgcatggcgccggaaaccgagcagcgcctggcggcgttctgc
aaggccatcgacaagttgccggtgccggtcgccggcacgccgggcttcctggtcaaccgg
gtgctgttcccgtacatgctcgaagccggcaccgccttcgccgaaggcatcccgggcccg
gcgatcgacaaggccgcggtcaagttcggcatgccgatgggcccgatcgaattgatcgac
accgtcggcctggacgtcgccgccggtgtaggcgccgaactcgcgcccttcctcggcctg
accgtgccctcggccctgagcaacgtcgagccgggcaagcgcggcaagaaggacggccag
ggcctgtacaagtgggagaacggccgtgcccagaagccggagctgtcgaaggactacaag
gccccgaacgatctcgaagaccgcctgatcctgcccttgatcaacgaagccgtggcctgc
ctgcacgacggtgtggtcagcgacggcgacctgctcgacgccggcgtgatcttcggcacc
ggcttcgccccgttccgtggcggcccgatccagtacgttcgcgaaaacggccccgacgcc
gtgctcgcacgcctcaagcagttgcaggcccgctacggcgaccgcttcgccccgcgcccc
ggctgggattcgccgctgttacgcaagtaa

DBGET integrated database retrieval system