KEGG   Leisingera aquaemixtae: R2C4_14675Help
Entry
R2C4_14675        CDS       T06085                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
laqu  Leisingera aquaemixtae
Pathway
laqu00061  Fatty acid biosynthesis
laqu00780  Biotin metabolism
laqu01100  Metabolic pathways
laqu01130  Biosynthesis of antibiotics
laqu01212  Fatty acid metabolism
Module
laqu_M00083  Fatty acid biosynthesis, elongation
laqu_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:laqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    R2C4_14675
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    R2C4_14675
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    R2C4_14675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:laqu01004]
    R2C4_14675
Enzymes [BR:laqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     R2C4_14675
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     R2C4_14675
Lipid biosynthesis proteins [BR:laqu01004]
 Fatty acid synthase
  Component type
   R2C4_14675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: QDI76935
LinkDB All DBs
Position
2653898..2654689
Genome map
AA seq 263 aa AA seqDB search
MAGLLTGKRGLIMGVANDRSIAWGIAKAMADAGAELAFTYQGEAFGKRLEPLAQSVGSDF
MVDVDVTDDVSLDAAFEQLSARWPTIDFVVHAIAYSDKSELTGRFLNTTRANFKNSMDIS
AYSFIEVARRAYPLMKDNGGTLLTLTYQGSNRVVPNYNVMGVAKAALESATRYLANDLGP
EGIRVNAISPGPMKTLAGAAIGGARKTFKHTAQNAPLRDNATLEAVGGTAVYLASDAGAC
TTGEVIRVDGGFHVLGMPQQDHL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacttctgaccggcaagcgcggcctgatcatgggcgttgccaacgaccgctcc
atcgcctggggcattgccaaggccatggcggacgccggggccgagctggcctttacctat
cagggcgaggccttcggcaagcggctggagccgctggcccaaagcgtcggctcggatttc
atggtcgacgtggatgtgaccgacgacgtctcgctggacgccgcgttcgaacagctgtcg
gcacgctggcccacgatcgacttcgtggtgcatgcgattgcctattcggacaagtcggag
ctgaccgggcggttcctgaacaccacccgcgccaacttcaagaactcgatggatatctcc
gcctattccttcatcgaggtggcgcgccgcgcctacccgctgatgaaggacaacggcggc
accctcttgaccctgacctatcaggggtcgaaccgggttgtgccgaactacaacgtgatg
ggcgtggccaaggcggcgctggaatcggcgacccgctatttggccaacgatctgggcccg
gaaggcatccgggtgaacgcgatctcgcccgggccgatgaagaccctggcgggtgcggct
atcggcggtgcgcgcaagaccttcaagcacaccgcccagaacgcgccgctgcgcgataac
gcgacgctggaggcggtgggcggcactgccgtgtacctggcatccgacgccggcgcctgc
accacgggcgaggttatccgggtggacggcggcttccacgtgctggggatgccgcagcag
gatcacctgtaa

DBGET integrated database retrieval system