KEGG   Candidatus Liberibacter americanus: lam_190Help
Entry
lam_190           CDS       T02902                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
lar  Candidatus Liberibacter americanus
Pathway
lar00061  Fatty acid biosynthesis
lar00780  Biotin metabolism
lar01100  Metabolic pathways
lar01212  Fatty acid metabolism
Module
lar_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    lam_190 (fabA)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    lam_190 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lar01004]
    lam_190 (fabA)
Enzymes [BR:lar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     lam_190 (fabA)
Lipid biosynthesis proteins [BR:lar01004]
 Fatty acid synthase
  Component type
   lam_190 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: AHA27564
UniProt: U6B3C7
LinkDB All DBs
Position
227713..228177
Genome map
AA seq 154 aa AA seqDB search
MESDVSCLYGKDIVELMKFLPHRYPFLLVDKIIDINGDNSAIGIKNVTFNEPHFMGHFPG
MPVMPGVLIIEGMAQTAGAICAIKNGFDNKKAAYLMTVDKARFRKPVIPGDRLEFHVCKL
RSRLTAWKFMCHAKVNGTVVSEAEIGAIVARDKD
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgatgtatcttgcttatatggaaaagatattgttgagttaatgaaatttttg
ccacataggtatccttttttgcttgttgataaaataattgatattaatggtgataattct
gctataggtattaagaatgttacgttcaatgagcctcattttatgggtcattttcctgga
atgccagtaatgcctggtgttcttataattgaaggtatggctcaaactgcaggtgctatt
tgtgcgattaaaaatggttttgataataagaaggcggcttatcttatgacagttgacaag
gctcgtttccgtaaaccagtcattccaggagatcgtttggaatttcatgtttgcaaatta
cgtagtcgtcttactgcttggaaatttatgtgtcatgcaaaagttaatggcactgttgta
tctgaagcagagataggagctattgttgcgcgtgataaggactag

DBGET integrated database retrieval system