KEGG   Candidatus Liberibacter asiaticus Ishi-1: CGUJ_02925Help
Entry
CGUJ_02925        CDS       T03607                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase 1penicillin-binding protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
lat  Candidatus Liberibacter asiaticus Ishi-1
Brite
KEGG Orthology (KO) [BR:lat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CGUJ_02925
Enzymes [BR:lat01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CGUJ_02925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: BAP26387
LinkDB All DBs
Position
complement(561656..562537)
Genome map
AA seq 293 aa AA seqDB search
MASELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQ
IPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMS
NKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRI
ITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKALEL
ITSFLEKKTLKHQQTHRKDNLSSTSLKKSLMIKKLKRTYSQFKKIDAKAHSTQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagaattacatgcaaaacccaaatattctagtattgttattgatgttaacaaa
aaccaaatgactgggtttaaacaagacgaaccacgctatccagcatccctaacaaaaatg
atgactctgtatattatttttgaatacttacagtcaaaaaaattacacttaaatacacaa
atccctgtatccaaaacagcagccacacaaaatccatctaaactctatttaaaagaaaaa
acgtactttaccacagaacaaggcattctagcactgattacacgttctgctaacgacgtt
tctacagcttttggagagttcattagcggttcagagaaaaagtttgcaatcctcatgtct
aataaagctaaaaaaattggcatgcagaataccatttataaaaatgctagcggactacat
gacaaaaaccaaataacgacagcacgcgatcaagcaattcttggcatattgcttcgcaaa
aacttcccacaatactataaatatttttcgattcgtaaattccgatatagaaatagaatt
attacaaaccacaataagttattaaataagatgcataacatagacggtatcaaaaccgga
tatactcgaaattcagggtttaacattgtcacctctttacgatataaagatgacccaata
gttgctgttgttatgggaatgccaaccagtcaggaaagagatcaaaaagccttagaactc
attacctcatttctggaaaagaaaaccttgaaacatcaacaaactcacagaaaagataat
ctttcatctacatctctcaaaaaatctttgatgataaagaaactcaaacgtacgtactct
caattcaaaaaaattgacgcaaaagcacactccactcaataa

DBGET integrated database retrieval system