KEGG   Candidatus Liberibacter africanus: G293_00090Help
Entry
G293_00090        CDS       T03953                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lau  Candidatus Liberibacter africanus
Pathway
lau00970  Aminoacyl-tRNA biosynthesis
lau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lau00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    G293_00090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lau03029]
    G293_00090
Enzymes [BR:lau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     G293_00090
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     G293_00090
Mitochondrial biogenesis [BR:lau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    G293_00090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AKK19682
UniProt: A0A0G3I7J1
LinkDB All DBs
Position
15876..17378
Genome map
AA seq 500 aa AA seqDB search
MVSIDTHVTNSESFISGTTGTWEVVIGMEVHAQLSVVSKLFSGASVDFGANPNTQVSFFD
AAMPGMLPILNSECVRQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHNEPIVG
EGKVFVSIGPNKSGQFKTIEVGIERIHLEQDAGKSIHDQHSSVSRIDLNRSGIALMEIVT
KPDMRSSLEAKAFLTKLRSILRYLGTCNGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV
NSIRFLGNAIEYEARRQIAILEDGGHIIQETRLFDPSKNETRSLRTKEDAHDYRYFSEPD
LLPLEIDESFIREIKEQLPELPDAKRERFIQEFGISFYDASVLVSDKSIADYFEKLATNR
DQKISANWVINDLLGALNKSGKNIEETPILPDQLGELIDLIIDGTISGKIAKDIFNILWE
KGGNPKQIVEELGLRQVTDLSAIEKIVDEVINSNPDNVARIKTKPNLIGWFVGQVMKNTG
GKANPSIVQKIVKEKLGIKE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaattgatacacatgttactaattcagaatctttcatatctggtacgacagga
acttgggaagtcgttataggaatggaagtacatgctcaattatctgttgtttcaaaatta
ttttcaggtgcgtctgttgactttggtgctaatcctaatacacaagtaagtttttttgat
gcggcaatgccaggaatgttgccaatattgaacagtgagtgtgttcgacaagcagttatg
acgggtcttggattaaatgctcatattaataaatactctgtttttgcaaggaaaaattat
ttctatccagatcttccacaaggatatcagatttcacaacataacgaacctattgtggga
gaaggtaaagtctttgtatccatcggtccaaataaatcaggtcaatttaaaacaatagag
gtaggaatagaacgtattcatctagaacaagatgcaggaaaatctattcatgatcagcat
tcatctgtttctcgtattgatcttaatcgttctggtatagcgcttatggaaatagtgacc
aagccagacatgcgttcttcactggaagctaaagcatttttgactaaattacgcagtata
ttgcgttatttaggaacttgtaatggaaatatggaagaaggttcaatgcgtgctgatgtc
aacgtttctgtttgtcgtcctggagaagcatggggtacgcgttgtgaagttaaaaatgta
aattctattcgttttttaggtaatgctattgaatatgaagcacgtcgccaaatcgccatt
cttgaagatggaggacatattatacaagaaactcgtttatttgatccatcaaaaaacgaa
acacgttctctacgcactaaagaagacgcgcatgattatcgttatttttctgaaccagac
ttacttcccttagaaattgatgaaagttttatacgcgaaattaaagaacaacttccagaa
cttcctgatgccaagagagaacgttttatccaagaatttggtatttctttttatgatgct
tctgtcctagtttctgataaatcaatcgcagattatttcgaaaaattagcaacgaatcgt
gatcaaaaaatctctgctaattgggttattaacgatcttctaggtgcgcttaataaatcg
gggaaaaatatagaagagacacctatcttacctgatcaattaggagaattaattgacttg
ataattgatggaacaatatcaggaaaaattgcaaaagatatttttaatatattatgggaa
aaaggaggtaatccaaagcaaatcgtggaagagcttggattacgccaagtaactgacctt
tctgctattgaaaaaattgttgatgaagtaattaattctaatcccgataatgttgcacga
ataaaaacaaaacctaacctaattggatggtttgttggacaagttatgaaaaatacgggg
ggaaaagctaaccctagtatagtgcaaaaaatagtgaaagaaaaattagggataaaggaa
taa

DBGET integrated database retrieval system