KEGG   Loxodonta africana (African savanna elephant): 100141371Help
Entry
100141371         CDS       T04351                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00020  Citrate cycle (TCA cycle)
lav00190  Oxidative phosphorylation
lav01100  Metabolic pathways
lav01200  Carbon metabolism
lav04714  Thermogenesis
lav04932  Non-alcoholic fatty liver disease (NAFLD)
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05016  Huntington disease
Module
lav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lav_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100141371 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100141371 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100141371 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100141371 (SDHA)
   05012 Parkinson disease
    100141371 (SDHA)
   05016 Huntington disease
    100141371 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100141371 (SDHA)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100141371 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 100141371
NCBI-ProteinID: XP_010600335
LinkDB All DBs
Position
Unknown
AA seq 551 aa AA seqDB search
MEEDDWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAF
GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRG
VIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTTTGDGTGMVTRAGLPCQDLEFV
QFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIRE
GRGCGPEKDHVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGI
PTNYRGQVLKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAE
SYKPGDKVPPIKPNAGEESVANLDKLRFANGSIRTSELRLSMQKSMQSHAAVFRVGSVLQ
EGCEKITQLYGDLQHLKTFDRGMAWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHA
REDYKVRIDEYDYSKPVQGQQKKPFAEHWRKHTLSYVDVKTGKVTLEYRPVIDKTLNETD
CATVPPAIRSY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacgactggaggtggcatttctatgacaccgtgaagggatcggactggctg
ggggaccaggatgccatccactacatgacagagcaggctcccgcctcggtggttgagcta
gaaaattatggcatgccattcagcagaaccgaagatgggaagatttaccagcgtgcattt
ggcgggcagagcctcaagttcgggaagggcgggcaggcccaccggtgctgctgtgtggcc
gaccggactggccactcactgctgcacacgctgtatggccggtctctgagatatgacacc
agctattttgttgagtattttgccttggaccttctgatggagaatggggagtgtcgtggt
gtcattgcactgtgcatagaagacgggtccatccatcgcatacgtgccaagaacactgtt
gttgccactgggggctacgggcgcacctacttcagctgcacttctgcccacaccaccacc
ggtgacgggaccggtatggtcaccagagcaggcctgccctgccaggacctggagtttgtc
cagttccaccccacaggcatatacggtgctggctgtctgatcacggaagggtgccgtgga
gaggggggcatccttattaacagtcagggtgagaggttcatggagagatacgcacctgtt
gcaaaggacctggcttccagagacgtcgtgtctcgctccatgacgctagaaatccgtgaa
ggaagaggttgtggtcctgagaaggaccacgtctacctgcagctgcaccacctccccccc
gagcagctggccatgcgcctgccgggcatctcggagacagccatgatcttcgccggcgtg
gatgtcaccaaggagcccatccctgtgctcccaacagtgcactacaacatgggcggcatc
cccaccaactaccggggccaggttttgaagcacgtgaatggccaggaccaggtcgtgcca
ggcctgtacgcctgtggagaggctgcctgtgcctcggtgcatggtgccaaccgccttggg
gcaaactcgctcctggacctggttgtcttcggcagggcctgtgccctgagtatcgcagag
tcctacaaacccggagataaagttcccccgattaaaccaaatgctggggaagagtctgtt
gcaaatctggacaagttgagatttgcaaatggaagcataaggacgtcagagctgcgactc
agcatgcagaagtcgatgcagagccatgcggcagtgttccgggtgggcagcgtgctgcag
gagggctgtgagaagatcacccagctgtacggggacctgcagcacctgaagacattcgac
aggggaatggcctggaacaccgatctggtggagaccctggagctgcagaacctgatgctc
tgtgcactgcagaccatttatggggccgaggcccggaaggagtctcgcggtgcccacgcc
agggaggactacaaggtgcggattgatgagtacgattattctaaacctgttcaagggcag
cagaagaaaccatttgcagagcactggagaaagcacaccctctcttatgtcgatgtcaag
acggggaaggtcactctggaatacagacctgtaattgacaaaactttaaacgaaactgac
tgtgccacagtgccgcctgctattcgctcctactga

DBGET integrated database retrieval system