KEGG   Loxodonta africana (African savanna elephant): 100141376Help
Entry
100141376         CDS       T04351                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00020  Citrate cycle (TCA cycle)
lav00190  Oxidative phosphorylation
lav01100  Metabolic pathways
lav01200  Carbon metabolism
lav04714  Thermogenesis
lav04932  Non-alcoholic fatty liver disease (NAFLD)
lav05010  Alzheimer's disease
lav05012  Parkinson's disease
lav05016  Huntington's disease
Module
lav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lav_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100141376 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    100141376 (SDHB)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    100141376 (SDHB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100141376 (SDHB)
   05012 Parkinson's disease
    100141376 (SDHB)
   05016 Huntington's disease
    100141376 (SDHB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100141376 (SDHB)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100141376 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 100141376
NCBI-ProteinID: XP_003413492
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAAVVGVSLRRWFPATTLGGACLQACRGAQTAAAVAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEIDATLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRACPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtggttggagtctccttgaggcgctggttcccggccactacccttggcgga
gcctgcctgcaggcctgccgtggggcccaaacagctgcagccgtagctccccgaatcaag
aaatttgccatctatcggtgggatccagataaggccggagataagcctcacatgcaaact
tacgaagttgatctgaataaatgtggtcctatggtattggatgctttgatcaagattaag
aatgaaatcgatgctaccttgacctttcgaagatcatgcagagaaggtatctgtggctct
tgtgcgatgaacatcaatggaggcaacactctagcttgcactcgcaggattgacaccaac
ctcaataaagtctcaaaaatctaccctcttccacatatgtatgtgataaaagatcttgtc
cctgatttgagcaacttctacgctcagtacaaatccattgagccttatttgaagaagaag
gatgaatcccaggaaggcaagcagcagtacctgcagtccatagaagatcgtgagaaactg
gatgggctgtatgagtgcattctctgtgcctgctgcagcaccagctgccctagctactgg
tggaacggagacaagtatttgggacctgcggttcttatgcaggcctatcgctggatgatc
gactctagagacgacttcacagaggaacgcctggccaagctgcaggaccccttctctctg
taccgctgccataccatcatgaactgcacaagggcctgtcccaagggtctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggcaacctataaggagaagaaagcttctgct
taa

DBGET integrated database retrieval system