KEGG   Loxodonta africana (African savanna elephant): 100653528
Entry
100653528         CDS       T04351                                 

Gene name
IRAK4
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04064  NF-kappa B signaling pathway
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04722  Neurotrophin signaling pathway
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100653528 (IRAK4)
   04064 NF-kappa B signaling pathway
    100653528 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100653528 (IRAK4)
   04621 NOD-like receptor signaling pathway
    100653528 (IRAK4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100653528 (IRAK4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100653528 (IRAK4)
   05135 Yersinia infection
    100653528 (IRAK4)
   05133 Pertussis
    100653528 (IRAK4)
   05152 Tuberculosis
    100653528 (IRAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100653528 (IRAK4)
   05161 Hepatitis B
    100653528 (IRAK4)
   05171 Coronavirus disease - COVID-19
    100653528 (IRAK4)
   05164 Influenza A
    100653528 (IRAK4)
   05162 Measles
    100653528 (IRAK4)
   05168 Herpes simplex virus 1 infection
    100653528 (IRAK4)
   05169 Epstein-Barr virus infection
    100653528 (IRAK4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100653528 (IRAK4)
   05140 Leishmaniasis
    100653528 (IRAK4)
   05142 Chagas disease
    100653528 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100653528 (IRAK4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100653528 (IRAK4)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: TKL group
  IRAK family
   100653528 (IRAK4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal Death
Other DBs
NCBI-GeneID: 100653528
NCBI-ProteinID: XP_010594256
LinkDB
Position
Unknown
AA seq 460 aa
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
HTGKSPTSELLFDWGTTNCTVGDLVDLLVQNEFLAPASLLLPDAVPKTVNTIPSQEAVTV
QQKQVSLFDKVRTSVMPVQNPELNYMPPDSSSAENESLEVSDTRFHSFSFFELKNVTNNF
DERPLSAGGNKMGEGGFGVVYKGCVNNRTVAVKKLAAMVDISTEELRQQFDQEIKVMAKC
QHENLVELLGFSSDGDGLCLVYVYMPNGSLLDRLSCLDGTPPISWHMRCGIAQGAADGIG
FLHENNHIHRDIKSANILLDENFIAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDLKMTD
IDSSSVETMYSIASQCLHEKKNKRPDIKKVQQLLQEMTTS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaacaaacccataactccatcgacatatgtacgctgcctcaacgttggactcattaga
aagctgtcagattttattgatcctcaagaaggatggaagaagttagctgtagctattaaa
aaaccatctggtgatgatagatacaatcagtttcacatacggagatttgaagcattactt
catactggaaaaagtcccacttctgagttgctgtttgactggggtaccactaattgcaca
gttggtgatcttgtggatcttttggtacaaaatgagtttcttgcccctgcaagtcttttg
ctgccagatgctgttcccaaaactgtgaacacaataccttctcaagaagctgtaacagtt
cagcagaaacaggtatctctctttgacaaagtcaggacatctgtgatgccagtgcagaat
cctgaactaaactatatgccacctgactcctcaagtgcagaaaatgaaagtttagaagtt
agtgatacacgttttcacagtttttcatttttcgaattgaagaatgtcacaaataacttt
gatgaacgacccctttctgctggtggtaacaaaatgggggagggaggatttggagtcgtg
tataaaggctgtgtgaacaacagaactgtggcggtgaagaagcttgcagcaatggttgac
attagtactgaagaactgagacaacagtttgatcaagaaataaaagtaatggcaaagtgt
caacatgaaaacttagtagaactacttggtttctctagtgatggagatggtctctgctta
gtatatgtttacatgcccaatggttcattgcttgacagactgtcttgcttggatggtact
ccaccaatttcttggcacatgagatgcgggattgcacaaggtgcagctgatggcatcggt
tttttacacgaaaacaatcatattcacagagatatcaaaagtgcaaatatcttactagat
gaaaactttatagccaaaatttctgactttgggcttgcacgggcttctgagaagtttgcc
cagacagtcatgactagcagaatcgtgggaacaacagcttatatggcacctgaagcttta
cgaggagaaatcacacccaaatctgatatctacagctttggtgtggttttactagaaata
ataactggacttccagctgtggatgaacaccgtgaaccccagttactgctagatatcaaa
gaagaaattgaagatgaagaaaagacaattgaagattatatcgatctgaagatgactgac
attgattccagttcagttgaaactatgtactctattgctagtcaatgtctgcatgaaaag
aaaaataagagaccagacataaagaaggttcaacagctgctgcaagagatgacaacttca
tga

KEGG   Loxodonta africana (African savanna elephant): 100676181
Entry
100676181         CDS       T04351                                 

Gene name
IRAK1
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-1 receptor-associated kinase 1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04064  NF-kappa B signaling pathway
lav04620  Toll-like receptor signaling pathway
lav04722  Neurotrophin signaling pathway
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100676181 (IRAK1)
   04064 NF-kappa B signaling pathway
    100676181 (IRAK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100676181 (IRAK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100676181 (IRAK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100676181 (IRAK1)
   05135 Yersinia infection
    100676181 (IRAK1)
   05133 Pertussis
    100676181 (IRAK1)
   05152 Tuberculosis
    100676181 (IRAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100676181 (IRAK1)
   05161 Hepatitis B
    100676181 (IRAK1)
   05171 Coronavirus disease - COVID-19
    100676181 (IRAK1)
   05162 Measles
    100676181 (IRAK1)
   05168 Herpes simplex virus 1 infection
    100676181 (IRAK1)
   05169 Epstein-Barr virus infection
    100676181 (IRAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100676181 (IRAK1)
   05140 Leishmaniasis
    100676181 (IRAK1)
   05142 Chagas disease
    100676181 (IRAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100676181 (IRAK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100676181 (IRAK1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: TKL group
  IRAK family
   100676181 (IRAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Death RAMP Seadorna_VP7
Other DBs
NCBI-GeneID: 100676181
NCBI-ProteinID: XP_023396507
LinkDB
Position
Unknown
AA seq 831 aa
MAGGPGPGDPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTVSVLWPWINRNGPRDDLVRILTHLQEAQVLKQTDTPGGRGPRRHSPSPFPPPCT
GHPPAPLPPPTATTQPLGPSSISVPSEAKARSPRKSQSSASTLLSPGSQTHPGPHLGPTA
HPAVPRPALPTPAPCSTEQSPESPLAFLQGAHPAPFCWPLPEIAQGTRNFSEELKIGEGG
FGCVYRAVMRNTVYAVKRLKEDADLEWNAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQSG
FYCLVYGFLPNGSLEDRLHFQTPACAPLSWPQRMDILVGTARAIQFLHQDSPSLIHGDVK
SSNVLLDERLMPKLGDFGLARFSRFTGASPGQSSAVARTRTVRGTLAYLPEEYVKTGKLA
VETDTFSFGVVVLETLVGQRAVRTQGTGTKYLKDLVEEEAEEAGVALKGGHTTAQAGLAS
DAWAAPIAAQIYKKHVDPRPGPCPPKLGQPLGQLACCCLHRRAKRRPPMTQVYERLEELQ
AAAGLPLEPAEPTGRGPPSPQENSYVSTAGIAPSRGAPWQPLAAPSRGLAQAADQLRKGP
NEPVESDESMSGLSGALCSWHLTPSPPPGPALPGSPGQGAATWAPAPLRLASCTQAGGVT
GESNWGSGPGSWPTALEGSPLASTTSSEPPQIVINPARQKMVQKLALYEDGVLDSLQLLS
SSSLPGTPEAGWMGQIPWRLALLPAATGPDSAGRPLPQGGLKTQPPLPPHPFSLGKLSTL
PQFPTFSCEPWLPLTTPFSAWGCQPSLMLPETKKPSENFPFQMLLEELLKV
NT seq 2496 nt   +upstreamnt  +downstreamnt
atggccgggggcccgggcccgggggaccccgcggcccccggcgcccagcacttcttgtac
gaggtgccgccctgggtcatgtgccgcttctacaaggtgatggacgccctggagcctgcc
gactggtgccagttcgcggccctgatcgtacgcgatcagaccgagcttcggctctgcgag
cgctcgggacagcgcacggtcagcgtcctgtggccctggatcaatcgcaacggcccgcgt
gacgacctcgtgcgcattctcacgcacctgcaggaagcgcaagtacttaagcaaactgac
acccccgggggccgggggccgaggcgccactcaccctctccctttcctccgccatgcaca
gggcatcctcctgcccctctcccgccccccaccgccaccacccagcccctggggcccagc
agcatctctgtcccctctgaggccaaggccaggagccccaggaagtcgcagtcctcagcc
tccaccctcctctccccaggttcccagacccatcctgggccccacctcggccccaccgca
caccctgccgtcccccgaccagcactgccaactccagccccttgctccaccgagcagagc
ccagagagcccactggctttcctgcagggggcccaccctgccccgttctgctggcccctc
cctgagattgcccagggcacccgcaacttctccgaggagctcaagatcggtgagggtggt
tttggctgcgtgtaccgggcggtgatgaggaacacggtgtatgctgtgaagaggctgaag
gaggacgccgatctggagtggaacgctgtgaagcagagcttcctgactgaggtggagcag
ctgtcccggtttcgtcacccaaacattgtggactttgccggctactgtgctcagagcggc
ttctactgcctagtctacggcttcctgcccaatggttccttggaagaccgcctccacttc
cagaccccggcctgcgcccccctctcctggcctcagcgaatggacatccttgtgggcaca
gcccgggcaattcagttcttacaccaggacagccccagcctcatccacggggatgtcaag
agttccaatgtcctcctggatgagagactgatgcccaagctgggagactttggcctcgcc
cgttttagccgctttactggtgccagccctggccaaagcagtgccgtggcccggactcgg
acggtgcggggcaccctggcctacctgcccgaggaatatgtcaagacagggaagctggcc
gtggagaccgacactttcagctttggggtggtggtgctggagaccctggtgggccagagg
gctgtgagaacacagggaactgggaccaagtacctgaaggacctggtcgaagaggaggcg
gaggaggccggggtggccctgaaaggtggccacaccacagcgcaggcaggtctggcctcg
gatgcctgggctgctccaatcgctgcccagatctacaagaaacacgtggatcccaggccc
gggccctgcccacccaagctaggccagcccctgggccagctggcctgctgctgcctgcac
cgcagggctaagaggaggccccccatgacccaggtgtacgagaggcttgaggagctgcag
gcagcagcagggctgcccctggagcctgctgagcccaccggccgtggtccaccctcccca
caggagaactcctatgtatccaccgccggcattgccccaagcaggggcgccccctggcag
cccctggcagcgccatccagaggcctggcccaggctgcagaccagctccggaaaggcccc
aacgagcctgtggagagcgacgagagcatgtccggcctctctggtgccttgtgctcctgg
cacttgactccaagcccccccccaggcccggccctgccaggcagccctgggcaaggagct
gccacctgggccccagcgcccctcagactggccagctgcactcaggcagggggtgtcacc
ggagagtcaaattgggggagcggcccggggtcctggcccacagccttggaagggtcaccg
ctggctagtaccacatcatctgagccaccgcagatcgtcatcaaccccgcccgacagaag
atggtgcagaagctggccctgtacgaagatggggtgttggacagcctccagctgctgtcc
tcgagctcactcccaggtaccccagaggctgggtggatggggcagataccctggagactt
gcactcctgccagctgccacaggtcctgacagtgcaggcaggccactcccccaaggaggg
ctgaaaacccagccacccctgcccccccaccccttctccctcggcaagttgtcgactcta
ccccagttccctaccttctcctgtgaaccttggctgcccctgacaacacctttctctgcc
tggggttgccaaccctcgctgatgctcccagaaactaagaagcccagcgagaactttcca
ttccagatgctactggaagagcttcttaaggtgtga

DBGET integrated database retrieval system