KEGG   Loxodonta africana (African savanna elephant): 100653532
Entry
100653532         CDS       T04351                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav01522  Endocrine resistance
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04114  Oocyte meiosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04714  Thermogenesis
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04727  GABAergic synapse
lav04742  Taste transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04921  Oxytocin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04962  Vasopressin-regulated water reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04976  Bile secretion
lav05032  Morphine addiction
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100653532 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100653532 (ADCY6)
   04371 Apelin signaling pathway
    100653532 (ADCY6)
   04072 Phospholipase D signaling pathway
    100653532 (ADCY6)
   04024 cAMP signaling pathway
    100653532 (ADCY6)
   04022 cGMP-PKG signaling pathway
    100653532 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100653532 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100653532 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100653532 (ADCY6)
   04062 Chemokine signaling pathway
    100653532 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    100653532 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    100653532 (ADCY6)
   04912 GnRH signaling pathway
    100653532 (ADCY6)
   04913 Ovarian steroidogenesis
    100653532 (ADCY6)
   04915 Estrogen signaling pathway
    100653532 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100653532 (ADCY6)
   04921 Oxytocin signaling pathway
    100653532 (ADCY6)
   04926 Relaxin signaling pathway
    100653532 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    100653532 (ADCY6)
   04918 Thyroid hormone synthesis
    100653532 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100653532 (ADCY6)
   04916 Melanogenesis
    100653532 (ADCY6)
   04924 Renin secretion
    100653532 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100653532 (ADCY6)
   04927 Cortisol synthesis and secretion
    100653532 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100653532 (ADCY6)
   04270 Vascular smooth muscle contraction
    100653532 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    100653532 (ADCY6)
   04971 Gastric acid secretion
    100653532 (ADCY6)
   04972 Pancreatic secretion
    100653532 (ADCY6)
   04976 Bile secretion
    100653532 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100653532 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100653532 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    100653532 (ADCY6)
   04727 GABAergic synapse
    100653532 (ADCY6)
   04725 Cholinergic synapse
    100653532 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100653532 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    100653532 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100653532 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    100653532 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100653532 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100653532 (ADCY6)
   04714 Thermogenesis
    100653532 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100653532 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    100653532 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100653532 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100653532 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100653532 (ADCY6)
   05163 Human cytomegalovirus infection
    100653532 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100653532 (ADCY6)
Enzymes [BR:lav01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100653532 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 100653532
NCBI-ProteinID: XP_023411593
LinkDB
Position
Unknown
AA seq 1180 aa
MVVLIPSPSFPPSSMSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRTSGLCTPHYMSCL
QDAEPPSPTPAAPPRCPWQEEGFIRRGGPGKGTELGLRAVALGFEDTEATVAVGVAELAP
NMVPRSKGSCWHRLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLA
FHAVPARPQPAYVALLACAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGAL
AATPHSPSVGLWCPVFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQ
LGANVLLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQ
HVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTGLASQCTAQELVMTLNELF
ARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREVTGVN
VNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLEYLNGDY
EVELGRGGERNAYLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDR
AFSRTKDSKAFRQMGIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRF
LLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLVFPHSTLMLGIYASTFLLL
LITVLTCAVYSCGSLFPKALQHLSRNIVRSRAHSTAVGIFSVLLVFTSATANMFTCNHTP
IRTCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTAPTCNFPEYFVGNMLLSLLASS
VFLHISSIGKLAMILVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPA
PGRVALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLL
HNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLL
NEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLME
QMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQV
TTDLYQVLASKGYQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3543 nt   +upstreamnt  +downstreamnt
atggtggtattaataccatctccttcctttcctcccagcagcatgtcgtggtttagtggc
ctcctggttcccaaagtggatgaacggaaaacagcctggggtgaacgcaatgggcaaaag
cgtccgcgccgcgggacacggaccagtggcctctgcacgccccactatatgagctgcctc
caggatgcagagcctcccagccctactcctgcagctccccctcggtgcccctggcaggaa
gaaggcttcatccgcaggggtggcccaggcaagggcacagagctggggctgcgggcggtg
gccctgggctttgaggacacagaggcaacagtggcggtaggggtggccgagctggcgccc
aacatggtgccgaggagcaagggatcctgctggcaccgtctggtgcaggtattccagtca
aagcagttccgctctgccaaactggagcgcctgtaccagcggtacttcttccagatgaac
cagagcagcctgacgctgctgatggcggtgctggtactgctcacggctgtgctgctggcc
ttccacgccgtgcctgcccgccctcagcctgcctacgtggccctgctggcctgtgctgcc
accctcttcgtggctctcatggtggtgtgtaaccgacatagctttcgccaggactccatg
tgggtggtgagctacgtggtgctaggcatcctggcagctgtgcaggttgggggggccctg
gcagccacccctcacagcccctctgtaggcctctggtgccctgtgttctttgtctacatc
acctacacgctcctacccatccgcatgagggcggccgtcttcagtggcctgggtctctcc
accctgcatttgatcttggcctggcaactcaaccgtggagatgccttcctctggaagcag
ctcggtgccaacgtactgcttttcctctgcaccaatgtcattggcatctgcacacactac
ccggctgaggtgtctcagcgccaggcctttcaggagacccgtggctacatccaggcccgg
ctgcacctgcagcatgagaatcggcagcaggagcggctgctgctgtcagtgttgccccag
catgttgccatggagatgaaagaagacatcaacactaaaaaagaagacatgatgttccac
aagatctacatccagaagcatgacaacgtcagcatactgtttgctgacatcgaaggcttc
accggcttggcctcccagtgcaccgcacaagagctggtcatgaccctgaatgagctcttc
gcccgctttgacaagctggccgcggaaaatcattgcctgaggatcaagattttaggggat
tgctactactgtgtgtcagggctgccggaggcccgggcagaccatgcccactgctgtgtg
gagatgggaatggacatgatcgaggccatctcgctggtgcgcgaagtgacaggtgtgaat
gtgaatatgcgcgtgggcatccacagtgggcgtgtgcactgcggtgtcctcggccttcgg
aaatggcagtttgatgtgtggtccaatgatgtgaccctggccaaccacatggaggccggg
ggccgggccggccgcatccacatcactcgggccacgctggagtacctgaatggggactac
gaggtggagttgggccgaggtggggagcgcaacgcatacctcaaggagcagcacattgag
accttcctcatcctgggcgccagccagaagcggaaagaggagaaggccatgctggccaag
ttgcaacggacacgggccaactccatggaggggctgatgccacgctgggtgcccgaccgt
gccttttcccgtaccaaggactccaaagctttccgccagatgggcattgatgattccagc
aaagacaaccggggtgcccaagacgccctgaaccccgaggatgaggtagacgagttcctg
ggccgtgccattgatgcacgtagcattgaccagctccgcaaggaccacgtgcgccggttc
ctgctcaccttccagagagaagaccttgagaagaagtactcgcggaaggtggatccccgc
ttcggagcctacgttgcctgtgccttgttggtcttctgctttatctgcttcatccagctc
ctcgtcttcccacactcaaccctgatgcttgggatctatgccagtaccttcctgctgttg
ctgatcactgtgctgacctgtgctgtgtactcttgtggttcactgttccctaaggccctg
caacatctgtcccgcaatatcgtccgctctcgggcacacagcactgcggttggcatcttt
tcagttctgcttgtcttcacctctgccactgccaacatgttcacctgtaaccacaccccc
atccggacctgtgcagcccggatgctgaatttaacacctgccgacatcaccgcctgccac
ctgcagcagctcaattactctctgggcctggatgctcccctgtgtgagggcaccgcacct
acctgcaacttccccgagtacttcgttggaaacatgctactgagtctcttggccagctct
gtcttcctacatatcagcagcatcgggaagttggccatgatccttgtcctggggctcatc
tatttggtgctgcttctgctgggtcccccggccaccatctttgacaactatgacctactg
cttggtgtccatggcttagcttcttccaacgagaccttcgatgggctagactgcccagct
cccgggagggtggcactcaagtatatgacccctgtgattctgctggtgtttgccctggcg
ctctatctgcatgcccagcaggtggagtcaactgcccgcttggacttcctctggaaactg
caggcaacaggggagaaggaggagatggaagagctccaggcctacaaccggcgactgctg
cacaacatcctgcccaaggatgtggccgcccactttctggcccgcgagcgccggaatgat
gagctttactatcagtcctgtgagtgtgtggctgtcatgtttgcttccatcgccaacttc
tctgagttttatgtggagctggaggcaaacaacgagggcgtagagtgcctacggctgctc
aacgagatcatcgcggactttgatgagatcatcagtgaggagcggttccggcagctggag
aaaatcaagacaattggcagcacctacatggctgcctcggggctgaacgccagcacctac
gatcaggtgggccgctcccacatcactgcccttgccgactatgccatgcggctcatggag
cagatgaagcacatcaatgagcactccttcaacaatttccagatgaagattggactgaac
atgggcccagtcgtagcaggtgtcattggggctcggaagccgcagtatgacatctggggg
aacacagtgaatgtctctagccgtatggacagcacaggggttcctgaccgaatccaggtg
accacggacctgtaccaggttttagcctccaagggctaccagctggagtgtcgaggggtg
gtcaaggtgaagggcaagggggagatgaccacctacttcctcaatgggggccccagcagt
tag

KEGG   Loxodonta africana (African savanna elephant): 100663448
Entry
100663448         CDS       T04351                                 

Gene name
ADCY9
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav01522  Endocrine resistance
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04114  Oocyte meiosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04714  Thermogenesis
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04727  GABAergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04921  Oxytocin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04962  Vasopressin-regulated water reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04976  Bile secretion
lav05032  Morphine addiction
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100663448 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100663448 (ADCY9)
   04371 Apelin signaling pathway
    100663448 (ADCY9)
   04020 Calcium signaling pathway
    100663448 (ADCY9)
   04072 Phospholipase D signaling pathway
    100663448 (ADCY9)
   04024 cAMP signaling pathway
    100663448 (ADCY9)
   04022 cGMP-PKG signaling pathway
    100663448 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100663448 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100663448 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100663448 (ADCY9)
   04062 Chemokine signaling pathway
    100663448 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    100663448 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    100663448 (ADCY9)
   04912 GnRH signaling pathway
    100663448 (ADCY9)
   04913 Ovarian steroidogenesis
    100663448 (ADCY9)
   04915 Estrogen signaling pathway
    100663448 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    100663448 (ADCY9)
   04921 Oxytocin signaling pathway
    100663448 (ADCY9)
   04926 Relaxin signaling pathway
    100663448 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    100663448 (ADCY9)
   04918 Thyroid hormone synthesis
    100663448 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    100663448 (ADCY9)
   04916 Melanogenesis
    100663448 (ADCY9)
   04925 Aldosterone synthesis and secretion
    100663448 (ADCY9)
   04927 Cortisol synthesis and secretion
    100663448 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100663448 (ADCY9)
   04270 Vascular smooth muscle contraction
    100663448 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    100663448 (ADCY9)
   04971 Gastric acid secretion
    100663448 (ADCY9)
   04972 Pancreatic secretion
    100663448 (ADCY9)
   04976 Bile secretion
    100663448 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100663448 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100663448 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    100663448 (ADCY9)
   04727 GABAergic synapse
    100663448 (ADCY9)
   04725 Cholinergic synapse
    100663448 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    100663448 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100663448 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    100663448 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    100663448 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100663448 (ADCY9)
   04714 Thermogenesis
    100663448 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663448 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    100663448 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100663448 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100663448 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100663448 (ADCY9)
   05163 Human cytomegalovirus infection
    100663448 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100663448 (ADCY9)
Enzymes [BR:lav01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100663448 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 100663448
NCBI-ProteinID: XP_003417791
LinkDB
Position
Unknown
AA seq 1344 aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSGSHPKHCKYSISSSCSSSGDS
GGAPRRVGVGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACMERCFPQTRRRFRYAL
FYIGFRLLAPGVSTFAGHMQSRLGVLVGPALIFFFTFSFTFTRLYARHYVCTALVLTLLV
FILTLALQFQVLTPLSGRADSSNHTPTVSPHSTCLSQVGSFSMCIEVLLLLYTVMHLPLY
LSLFLGVAYSILFETFGHHFRDADCFPPVWGALHWELLSRALLHLCIHAIGVHLLIMSQV
RSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDDDSENSVKRHPTS
SPKNKKKKFSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLSDLSW
SLQPLVXETQVXEISTLGDCYYCVAGCLEARGNHAYCCIEMGLADQAIQQFCQEKKNGEM
GCRVHGHVLCGLWGCGVKFNWGNDVNWANLMEQLGVAGKVHISESTAKYLDDRYEMEDGK
VFERLGQSVVADQLKGLKTYLISGQRAKESHCSCSEALLSGLKVIGGSQGSSGPRLQGTA
SPGSVSDLAQTVKTFDNLKTCLSCGITFAPKSEAGAEGGAVQNGCQDEHKNSSKASGGPN
SKAQNGLLSPPPEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNIREKTDAHFV
DVIKEDSLMKDYFFKPPINQFSLNFLDQELERTYRTSYQEEVIKNSPVKTFASATFSSLL
DVFLSTTVFLVLSVTCFLKYRATALSPPPAALAIFGVALVLEVLSLVVSVRMVFFLEDVM
LCTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHVTSEFETNIHFTTFVCSAILIAVVQY
CNFCQLSSWMRSSLATIVGAGPLLLLYISLCPDSSIIIAHLDAVQNFSSQGSPCSGSLPH
DSRKPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQAD
WLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELI
GDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQCQDSSHPQEHLQILFEFAKEMMRVV
DDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVS
EESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCIDNGIVPQHQLSISPDIRVQVDGS
IGRSPTDEIANLVPSVQNLDRASLSSDSSTQAKDVHLSSKRPWREPVRAEESCRFSKAME
KSDCEEVGLEEANELTKLNVSGSL
NT seq 4035 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggagacagcaacagcgtgcgggtcaaaatcaaccccaagcagctctcatctgga
agccaccccaagcactgcaagtacagcatctcctccagctgcagcagttcgggggactcc
gggggcgcgccccggagggtgggcgtcgggggccgcctgcgccggcagaagaagctgccg
cagctgttcgagagagcctccagccgctggtgggaccccaaattcgactcggtgaacctg
gaggaggcgtgcatggagcgctgcttcccgcaaacccggcgccgcttccgctatgcgctc
ttctacatcggctttcgcctgcttgctcctggagtgtctacttttgcgggccacatgcaa
tccagactgggggtcttggtaggccctgcccttattttcttttttaccttctcttttacc
ttcaccagactgtacgcccggcactacgtgtgcaccgcgctggtgctcactctcttggtg
ttcatcctcactctggccttgcagtttcaggttttgacgcctctctcaggacgcgctgac
agctccaatcacacacccacagtcagcccccactccacctgcttgtctcaagtggggagc
ttctccatgtgcatcgaagtgctccttttgctgtacactgtcatgcacttacctttgtat
ttgagcctgttcctgggagtggcctattctattctctttgagacctttggccaccatttc
cgagatgcagactgcttccctccggtgtggggagccctgcactgggagctgctgagcagg
gccttgctccacctctgcattcacgccatcggggtccacctgctcatcatgtcccaggtg
aggtccaggagcactttcctcaaggtggggcagtccattatgcacgggaaggatctggaa
gtagaaaaagccctcaaagagagaatgatccactctgtgatgcccagaatcatcgctgat
gacttaatgaaacagggtgatgatgacagtgagaattctgtcaaaaggcaccccacctcg
agccccaagaacaagaagaagaaattttctatacagaaagcgcctatagccttccgccct
tttaaaatgcagcagatcgaagaggtcagcattttgtttgcagacattgtgggcttcacc
aagatgagtgccaacaagtccgcgcatgccctggtagggcttctcagcgacttgtcgtgg
tctctccaaccgcttgtgtgagagacacaagtgtgagagatcagcacgttgggtgactgt
tactattgtgtggcagggtgtctcgaagcccggggaaaccatgcctactgctgcatcgaa
atgggcttggctgatcaagccatccaacagttctgccaggaaaaaaagaatggtgaaatg
ggttgtcgggttcacgggcacgttttgtgtgggctctggggttgcggagttaaattcaac
tggggtaatgatgtgaattgggccaacctcatggagcagctgggagtggctggcaaggtc
cacatttccgagtccactgcaaaatacttagatgatcggtacgaaatggaagacgggaag
gtgtttgagcgcctgggccagagtgtggtggctgaccagttgaaaggtctgaagacatac
ctgatatcgggtcagagagcgaaggagtctcattgcagctgttcagaggccttgctttct
ggcctcaaggtcattggcggctcccaggggtcttcaggccctaggttacaggggacagca
tcaccagggagtgtcagtgacttggcacagactgtcaaaacctttgataaccttaagacc
tgcctttcatgtggaattacgtttgctccaaaatctgaagctggtgcagaaggaggagca
gtccaaaatggctgtcaagacgagcataaaaacagcagcaaggcttctggaggacctaat
tccaaagcccagaatggacttctgagccctccaccagaggagaagcttaccaacagtcag
acctccctgtgtgagatcctacaggaaaagggaaggtgggcaggggtgagcttggaccaa
tctgccctccttccgttgagattcaagaatatccgggagaaaacagatgcccattttgtt
gatgttattaaagaagatagcctgatgaaagattatttttttaaaccacccattaatcag
ttcagcttgaacttcttggaccaggagctagagcgaacctacaggaccagctaccaagaa
gaggtcataaagaattctcccgtgaagacttttgccagtgccaccttcagttcccttctg
gatgtgtttctgtcaacaactgtgtttctagtcctctccgtcacctgcttcctgaagtac
agggccaccgccttgtccccaccgcctgctgccctggccatctttggtgtggccctggtg
ctggaggtgctctccctcgttgtctctgtcaggatggtgttcttcctggaagatgtcatg
ttgtgtaccaagcgcctgctggagtggatcgccggctggcttcctcgtcacttcatcgga
gcaatcctggtgtcactccctgcccttgccgtctattcccatgtcacctctgagtttgag
acaaacattcattttaccacgttcgtgtgctcagccatcctcatcgctgtcgtgcagtac
tgcaacttctgccagctcagctcctggatgcggtcctcgctggccaccattgttggggct
gggcccctgctcctgctttatatctccctgtgtccagacagttccataataattgcacac
cttgatgcagtacagaatttcagttcccaggggagtccctgcagtggctcactgccacat
gacagcaggaagccagccagtctgattggccaggaggtggttctcgtcttctttcttctg
ctcctcctggtctggttcctgaaccgagagttcgaagtcagctaccgcttacactaccat
ggcgacgtggaagcggaccttcaccgcaccaagatccagagcatgcgagaccaggctgac
tggctgctgagaaacatcattccttaccatgtggccgagcagctcaaggtgtctcagacc
tattccaagaaccatgacagtggaggggtcatcttcgccagcatcgtcaacttcagcgaa
ttctacgaggagaactacgaggggggcaaggagtgctaccgggtcctcaacgaactcatt
ggggactttgacgagctcctaagcaagccggactacagcagcattgagaagatcaagacc
attggggcgacctacatggctgcctcggggctgaacacggctcagtgccaggatagcagc
cacccgcaggaacacctgcagatcctgttcgagtttgccaaggagatgatgcgtgtggtg
gatgacttcaataacaacatgttgtggttcaacttcaaactccgtgtcggcttcaaccat
gggcccctgactgcaggggtcatcggcaccacaaagctgctgtacgatatctggggggac
acggtcaacattgccagcaggatggataccactggggtagaatgccgcattcaggtgagt
gaagagagctaccgggtcctgagcaagatgggctatgactttgactacagagggacagtg
aatgtcaaggggaaaggtcaaatgaagacctacctctaccccaagtgtatagacaacggg
atcgtgcctcaacaccagctgtccatctccccggacatccgggtccaggtggacgggagc
atcgggcggtcacccactgatgagatcgccaacctggtgccttctgtacagaatttggac
agggcgtctctgagttccgatagcagcacacaggccaaggatgtccacctgtcttctaag
aggccctggagggagcctgtcagagcagaagagagttgccgcttcagcaaagccatggag
aaaagcgactgtgaggaagtagggctggaggaagccaatgagctcaccaagctcaatgtc
tccgggagcttgtga

KEGG   Loxodonta africana (African savanna elephant): 100674724
Entry
100674724         CDS       T04351                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav01522  Endocrine resistance
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04072  Phospholipase D signaling pathway
lav04114  Oocyte meiosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04714  Thermogenesis
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04727  GABAergic synapse
lav04740  Olfactory transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04921  Oxytocin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04962  Vasopressin-regulated water reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04976  Bile secretion
lav05032  Morphine addiction
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100674724 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100674724 (ADCY3)
   04371 Apelin signaling pathway
    100674724 (ADCY3)
   04020 Calcium signaling pathway
    100674724 (ADCY3)
   04072 Phospholipase D signaling pathway
    100674724 (ADCY3)
   04024 cAMP signaling pathway
    100674724 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100674724 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100674724 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100674724 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100674724 (ADCY3)
   04062 Chemokine signaling pathway
    100674724 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100674724 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100674724 (ADCY3)
   04912 GnRH signaling pathway
    100674724 (ADCY3)
   04913 Ovarian steroidogenesis
    100674724 (ADCY3)
   04915 Estrogen signaling pathway
    100674724 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100674724 (ADCY3)
   04921 Oxytocin signaling pathway
    100674724 (ADCY3)
   04926 Relaxin signaling pathway
    100674724 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    100674724 (ADCY3)
   04918 Thyroid hormone synthesis
    100674724 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100674724 (ADCY3)
   04916 Melanogenesis
    100674724 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100674724 (ADCY3)
   04927 Cortisol synthesis and secretion
    100674724 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100674724 (ADCY3)
   04270 Vascular smooth muscle contraction
    100674724 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100674724 (ADCY3)
   04971 Gastric acid secretion
    100674724 (ADCY3)
   04972 Pancreatic secretion
    100674724 (ADCY3)
   04976 Bile secretion
    100674724 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100674724 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100674724 (ADCY3)
   04727 GABAergic synapse
    100674724 (ADCY3)
   04725 Cholinergic synapse
    100674724 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100674724 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100674724 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100674724 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100674724 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100674724 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100674724 (ADCY3)
   04714 Thermogenesis
    100674724 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674724 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100674724 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100674724 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100674724 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100674724 (ADCY3)
   05163 Human cytomegalovirus infection
    100674724 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100674724 (ADCY3)
Enzymes [BR:lav01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100674724 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101
Other DBs
NCBI-GeneID: 100674724
NCBI-ProteinID: XP_003411966
LinkDB
Position
Unknown
AA seq 1142 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRAVGRTHEISVRSSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSKDMLAPLIVAGIGLVLDII
LFVLCKKGVLPDRVTRKVVPYLLWLLITAQIFSYLGLNFAQAHTASDTVGWQAFFIFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDQLKGIQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMESGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPPFSKPSSPALIETKEPDGITTG
SISEEAEEHDAQADNPSFPNPRRRLHLQDLADRVVDASEDEHELNQLLNEALLERESAQV
VKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPGLMTNYV
TFVVGEVLLLVLTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMANVV
DMLSCLQYYTGPSNRTTGMEEQDGCVANPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLL
VTGAVAVINLYAWCPIFDEYDHRRFREHEVPITLEKMQVSSAPGLNGTDRLPLMPSKYSM
TVMMFVMLLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVANMLPEHVAR
HFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSL
LDNPKFRIITKIKTIGSTYMAASGVTPDVNTNGFTGSNKEEKSEKERWQHLADLADFALA
MKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGN
IQVVEETQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPAAFPNGSSVTLPHQVVD
NS
NT seq 3429 nt   +upstreamnt  +downstreamnt
atgcctcggaatcagggcttctctgatcccgagtactcagctgagtactcggctgaatac
tccgtcagcctgccctctgaccctgatcgagcggtgggccggacccatgaaatctccgtc
cggagctcggggtcttgcctctgcctgcctcgcttcatgcggctgaccttcgtgcctgag
tccttggagaacctctaccagacgtacttcaaaaggcagcgccatgagaccctgctggtg
ctggtggttttcgcagccctcttcgactgctacgtggtggtcatgtgcgccgtggtcttc
tccaaagacatgctggcgcccctcatcgtggccgggattggactggtgttggacatcatc
cttttcgtgctctgcaaaaagggggtgctccctgaccgggtcacccgcaaagtggtgccc
tacctgctgtggctgctgataacagcccagatcttctcctacctgggcctgaactttgcc
caggcccacacagccagcgacacggtgggttggcaggccttcttcatcttctccttcttc
atcacgctgcccctcagtctcagccccatcgtgatcatctcagttgtctcctgcgttgta
cacacgcttgtcttgggggtcaccgtggcccagcagcagcaggaccagctaaaggggatc
cagttgctgagggagatcctggccaacgtcttcctctacctgtgtgccatcatcgtgggc
atcatgtcttactacatggcagaccgcaagcaccgcaaggccttcctggaggctcgccag
tcgctggaagtgaagatgaacctggaagagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggctgacgagatgttgaaggacatgaagaaagatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgtcacgagaacgtcagcatc
ctctttgctgatatcgtgggcttcacccagctgtcctctgcctgcagtgcgcaggagcta
gtgaagcttctcaacgagctctttgcccgctttgacaagctggcagcgaaataccaccag
ctgcggattaagatcctgggtgactgttactactgcatctgtggcctgcctgactaccgg
gaggaccacgctgtctgctccatcctcatggggctggccatggtggaggccatctcgtat
gtgcgggagaagacaaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ttgggtggcgtcctgggccagaagcgctggcagtatgatgtgtggtccaccgacgtcacc
gtggccaacaagatggagtcaggcggcatcccagggcgcgtgcatatctcccagagcacc
atggactgcctgaaaggagagtttgacgtggagccaggcgatggaggcagccgctgcgat
tacctggaggagaagggcatcgaaacctacctcatcattgcatccaagccagaggtgaag
aaaacagccacccaaaatggcctcaacggctcggccctgccaaatggagcaccacctttc
tcaaagcccagctctcctgccctcatcgagaccaaggagcctgatgggatcaccaccgga
tctatatcggaggaggctgaggagcatgatgcccaggcagacaacccctcattccccaac
ccccgtcggaggctgcaccttcaggacctggctgatcgcgtggtggacgcctctgaggac
gaacatgagcttaaccagctgctcaacgaggccctgctggagcgagagtctgcacaggta
gtaaagaagagaaacaccttcctcctgtccatgcggtttatggacccggaaatggaaacc
cgctactcggtggagaaggaaaagcagagtggggccgccttcagctgctcctgcgttgtc
ctactctgtacagcgctggtcgagatactcatcgaccccgggctaatgacaaactacgtg
acctttgtggttggggaggttctgctcctggtcttgacaatctgctcgctggctgccatc
tttccccgggcctttcctaagaagctcgtggctttctcaacatggatcgaccggacccgc
tgggccaggaacacctgggccatgttagccatcttcattctggttatggcaaacgttgtg
gacatgcttagctgtctccagtactacacggggcccagcaacaggactacagggatggag
gagcaggacggctgcgtggcgaaccccaagtactacaactatgttgctgtgctgtccctc
atcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatgctgctc
gtcacaggcgcggtggccgtcatcaacctctatgcctggtgccccatctttgatgaatac
gaccacagacgttttcgggagcatgaggttcccatcaccttagagaagatgcaggtatct
tctgcccctgggctcaatgggaccgacaggctgcccctgatgccttccaagtactcaatg
acagtgatgatgttcgtcatgctgctgagcttttactacttctcccgccacgtggaaaaa
ctggcacggaccctgttcttgtggaagattgaggtccatgaccagaaggaacgtgtttat
gagatgcgacgctggaatgaggccttggtcgccaacatgttgcctgagcacgtggcccgc
catttcctgggttccaagaagagagatgaggagctgtacagccagtcttacgatgagatt
ggagtcatgtttgcttccttgcccaactttgctgacttctacacagaggagagcatcaat
aacggtggcattgagtgtctacgctttctcaatgaaatcatctcagatttcgactctctc
ctggacaatcccaaatttcggatcattaccaagatcaaaaccattggcagtacctatatg
gcagcttcaggagtcaccccagatgtcaacaccaacggttttactggctccaacaaggag
gaaaagtcggagaaggagcgctggcagcacctggctgatctggctgactttgcactggcc
atgaaggacacgcttacaaacatcaacaaccagtccttcaacaacttcatgctgcgcata
ggcatgaacaaaggaggggtactggctggcgtcattggagcccggaagccacactacgac
atctggggcaatacagtcaatgtagccagcaggatggagtccacgggggtcatgggcaac
atccaggtagtagaagaaacacaagccattctccgagagtacggtttccgcttcgtgagg
cgaggtcctatctttgtgaaggggaagggggagctgctgacctttttcctgaaggggcgc
gataagccagctgccttcccgaatggctcctctgtcacactgccccaccaggtggtagac
aactcctga

DBGET integrated database retrieval system