KEGG   Loxodonta africana (African savanna elephant): 100653538
Entry
100653538         CDS       T04351                                 

Gene name
GRIN2D
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor ionotropic, NMDA 2D
  KO
K05212  glutamate receptor ionotropic, NMDA 2D
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04724  Glutamatergic synapse
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05033  Nicotine addiction
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100653538 (GRIN2D)
   04024 cAMP signaling pathway
    100653538 (GRIN2D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100653538 (GRIN2D)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100653538 (GRIN2D)
   04720 Long-term potentiation
    100653538 (GRIN2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100653538 (GRIN2D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100653538 (GRIN2D)
   05014 Amyotrophic lateral sclerosis
    100653538 (GRIN2D)
   05017 Spinocerebellar ataxia
    100653538 (GRIN2D)
   05020 Prion disease
    100653538 (GRIN2D)
   05022 Pathways of neurodegeneration - multiple diseases
    100653538 (GRIN2D)
  09165 Substance dependence
   05030 Cocaine addiction
    100653538 (GRIN2D)
   05031 Amphetamine addiction
    100653538 (GRIN2D)
   05033 Nicotine addiction
    100653538 (GRIN2D)
   05034 Alcoholism
    100653538 (GRIN2D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100653538 (GRIN2D)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100653538 (GRIN2D)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor NMDAR2_C MatE
Other DBs
NCBI-GeneID: 100653538
NCBI-ProteinID: XP_010585264
LinkDB
Position
Unknown
AA seq 1244 aa
MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGPGGARPLNVALVFSGP
AYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDD
SRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLE
EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLGAQLRSVS
AQIRLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPL
PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRSHRGESL
HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLSRDRTWEVVGSWEQQTLRLKYPLWSRYG
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
KRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSL
TINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVT
VFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVL
VWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEK
NIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGS
GKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAE
AAPPPAKPPPPPQPLPSPAYPAARAPGPAPFVPRERAAVDRWRRAKGPGPPGGAGLADGF
HRYYGPIEPQGLGVGEARAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPPEPAAGA
FPGFPSPPAPPTVAAAAVGPPLCRLAFEDESPPAPARWPRSDPESQPLLGPGAGGAGVAG
GGPPAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASPPGPPAHGLGVGPRCGCPRPH
PHRPRASHRAPAGDAPHQQRHRRAAARCDLPPPAPTSRSLEDLSSCPRAAPPRRLTGLSR
HARRCPHAAHWGPPLSAAPHRRHRGGELGTRRGSAHFSSLESEV
NT seq 3735 nt   +upstreamnt  +downstreamnt
atgcgcggcgcaggtggcccccgcggccctcggggccccgctaagatgctgctgctgctg
gcgctggcctgcgccagcccgttcccggaggaggcgccggggccgggcggggccggcggg
ccaggtgggggccccggcggggcgcggccgctcaacgtggcgctcgtgttctcggggcca
gcgtacgcggccgaggcggcgcgcctgggcccggccgtggcggctgcagtgcgcagcccg
ggcctggacgtgcggcccgtggccctggtgctcaacggctcggacccccgcagcctcgtg
ctgcagctctgcgacctgctgtcggggctgcgcgtgcacggcgtcgtcttcgaggacgac
tcgcgcgcgcccgccgtcgcgcccatcctcgatttcctgtcggctcagacctcgctgccc
atcgtggccgtgcacggcggcgccgcgctcgtgctcacgcccaaggagaagggctccacc
ttcctacagctgggctcctccactgagcagcagcttcaggtcatcttcgaggtgctggag
gagtacgactggacgtccttcgtggcagtgaccacacgggctcccggccaccgggccttc
ctgtcctacatcgaggtgctgacggacggcagcctggtgggctgggagcaccgcggggcg
ctgacgctggacccaggggccggtgaggcagtgctgggggcccagctccgcagcgtcagt
gcgcagatccgcctgcttttctgtgcacgcgaggaggccgagccggtgttccgggccgcg
gaggaggctggcctcacgggacctggctacgtgtggttcatggtggggccccagctggcc
gggggagggggctctggggcgcccggagagcccccactcctgcctggaggcgccccgctg
cctgccggcctgttcgcggtgcgctcggccggctggagagacgacctggcccggcgcgtg
gccgccggcgtggccgtcgtggccagaggtgcccaggccctgttgcgtgattatggcttc
ctgcccgagctcggccatgactgtcgagcccagaaccgctcccaccgcggggagagtctg
cacaggtacttcatgaacatcacctgggataaccgggattactccttcaacgaggatggt
tttctggtgaacccctcccttgtggtcatctccctcagcagggacaggacttgggaggtg
gtgggcagctgggagcagcaaactctccgcctcaagtacccgctgtggtcccgctatggc
cgcttcctgcagccggtggatgacacacagcacctcacggtggccacactagaggagaga
ccctttgtcattgtggagccagccgaccccatcagcggcacgtgcatccgagactcagtc
ccctgccggagccaactcaaccgcacccacagccctccaccagacgccccccgcccggaa
aagcggtgctgcaaaggcttctgcatcgacattctgaagcggctggcgcacacgatcggc
ttcagctacgacctctacctggtcaccaacggcaagcacgggaagaagatagacggtgtc
tggaacggcatgatcggcgaggtgttctatcagcgcgcggacatggccatcggctccctc
accatcaatgaggagcggtctgagatcgtggacttctccgttccgttcgtggagacaggc
atcagcgtcatggtggctcgtagcaatggcaccgtgtccccctcggccttccttgagccc
tacagccccgccgtgtgggtgatgatgttcgtcatgtgcctcaccgtggtcgccgtcacc
gtcttcatctttgagtacctcagtccggtcggctacaaccgcagcctggccaccggcaag
cgccctggcggctcaaccttcaccattgggaaatccatctggctgctctgggccctggtg
ttcaataactcggtgcccgtggagaacccccgggggaccaccagcaaaatcatggtgctg
gtgtgggccttcttcgctgtcatcttcctcgccagctacacagccaacctcgccgccttc
atgatccaggaggagtatgtggacaccgtgtctgggctcagtgaccgcaagttccagcgg
ccccaggagcagtacccacccctgaagtttgggacggtgcccaatgggtccacagagaag
aacatccgcagcaactaccccgacatgcacagctacatggtgcgctacaaccagccccgc
gtagaggaagcgcttactcagctcaaggccggaaagctggacgccttcatctatgacgca
gctgtgctcaactacatggcccgcaaggatgagggctgcaagctggtcaccatcggctct
ggcaaggtctttgccacgacaggctatggcatcgcactgcacaagggctcccgctggaag
cggcccatcgacctggcgctgctgcagttcctgggggatgatgaaatcgagatgctagag
cggctgtggctctctgggatctgccacaatgacaagatcgaggtgatgagcagcaagctg
gacatcgacaacatggcaggagtcttctacatgctcctggtggccatgggtctctccctg
ctggtcttcgcctgggagcacctggtctactggcgcctgcggcactgcctggggcccacc
caccgcatggacttcctgctggctttctccaggggcatgtacagctgctgcagcgccgag
gccgctccgccgccagccaagcccccaccaccgccgcagccgctgccaagccccgcgtac
ccggcggcgcgggcgcccggtcctgcgccctttgtgccccgggagcgcgctgccgtggac
cgctggcgccgtgccaagggcccggggccaccgggcggcgcgggcctggccgacggcttc
caccgctactacggcccaatcgagccgcagggcctgggcgtgggcgaggcgcgcgcggct
ccccggggtgctgccggacgcccgctatccccgccggccgcgcagcccccacagaagccg
ccgccctcttacttcgccattgtgcgcgacaaggagcctcccgagcccgctgccggcgcc
ttccccggctttccgtccccgcccgcgccacctaccgtcgcggccgctgccgtcgggccg
ccgctgtgccgactggccttcgaggacgagagcccgccggcgcccgcgcgctggccgcgc
tcagacccggagagccagcctctgctgggacccggcgcgggcggcgctggggtcgcaggt
gggggacccccggcggcgccgccgccatgccgcgccgcgccgccgccctgcccgtacctc
gacctcgagccatcgccttcggactcggaggactcggagagcctgggaggcgcgtccccc
cctgggcccccggcccacggcctcggcgtcgggccccgctgtgggtgtccgcggcctcac
cctcaccgccctcgggcctcgcaccgcgccccagctggcgatgcgccgcaccaacaacgg
caccggcgagcagctgcgagatgtgacctcccgccgccggcgcccacctcgcgctcgctt
gaggacctcagctcctgcccccgcgccgctcccccgcgccgacttaccgggctctcgcgc
cacgcgcgccgctgcccgcacgccgctcactgggggccgccgctatctgccgcgccccac
cggagacaccggggcggggagctgggcacccgcaggggctcggcacacttctccagcctg
gagtccgaagtatga

KEGG   Loxodonta africana (African savanna elephant): 100656237
Entry
100656237         CDS       T04351                                 

Gene name
GRIN2C
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor ionotropic, NMDA 2C
  KO
K05211  glutamate receptor ionotropic, NMDA 2C
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04724  Glutamatergic synapse
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05033  Nicotine addiction
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100656237 (GRIN2C)
   04024 cAMP signaling pathway
    100656237 (GRIN2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100656237 (GRIN2C)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100656237 (GRIN2C)
   04720 Long-term potentiation
    100656237 (GRIN2C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100656237 (GRIN2C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100656237 (GRIN2C)
   05014 Amyotrophic lateral sclerosis
    100656237 (GRIN2C)
   05017 Spinocerebellar ataxia
    100656237 (GRIN2C)
   05020 Prion disease
    100656237 (GRIN2C)
   05022 Pathways of neurodegeneration - multiple diseases
    100656237 (GRIN2C)
  09165 Substance dependence
   05030 Cocaine addiction
    100656237 (GRIN2C)
   05031 Amphetamine addiction
    100656237 (GRIN2C)
   05033 Nicotine addiction
    100656237 (GRIN2C)
   05034 Alcoholism
    100656237 (GRIN2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100656237 (GRIN2C)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100656237 (GRIN2C)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 NMDAR2_C
Other DBs
NCBI-GeneID: 100656237
NCBI-ProteinID: XP_023412507
LinkDB
Position
Unknown
AA seq 1161 aa
MYLSTRLAFSLCLPGTEHRSMSFKRFDLSSQACSSAVEWRVVRAPSRLALLPSPCPSGIS
WGHSANLSVSSSLSVSVSLSLPFSSPLLSLPSSGCVSSDTGLCLLSVHLPLSVPVSLVVP
ALFSPKDPPVDMGGALGLALLLTSILGAWSGLGPGQGQQAVTVAVVFGSSGPPQAQARAH
FTPQSFLDLPLEIQPSRGGVNNTDPTASSPDLWLLGAARVHGIDFEEKRGARWGQIFDFL
SSQTHWGGRGRGRGTGHPASLPPPRHLLNVTWEGRDFSFSPGGYLVQPTMVVIALNRHRL
WEMVXXWEHGVLHMKYPVWPXYSASLQPVVDSRHLTVATLEERPFVIVESPDSGTGGCVP
NTVPCRRQNNHTFSGDAAPYTKLCCKGFCIDILKKLAKVVKFSYDLYLVTNGKHGKRVRG
VWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLE
PYSPSVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLASGKKSGGPSFTIGKSVWLLWAL
VFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDKKVL
EPXYPPFRFGTVPIGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKMGKLDAFIYDAA
VLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRPLDLALLQFLGDGETQKLET
VWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVYWKLRHSMPHTS
QLDFLLAFSRGIYSLLQRACRSLARPRAGGPARSSRPGLAQANVLKMLRPARNMVTTAGV
GSSLDRATRTIENWANRRAPPTPAAHSPTPRPPPEPSPKAWGPSGGGCAVLVHRTQQPPV
RPPTPAPSLPNDPRTLGRPAWDTRRLARAGRGRWHLSSSERRAPPESPLSPARCSYNSFP
RGDRAGRPFLPLFPEPPEPENLPLLGREQLARREALLHAAWARSPRPRHASLPSSVAAAF
ARPRSQSAACAGPTCACRDARLAWRLPAPSLRLPSYREACRGGMREGTPTWPHGQHACLH
AHAHLPLCWGAVCSHRPHCARHGPWFPGAWGPQGHGGRTVGLSTGYRDSGGLDEVSSVAC
EMHGLSSPCTWRRFSSLESEV
NT seq 3486 nt   +upstreamnt  +downstreamnt
atgtacttaagtaccaggctagcgttttcactgtgtcttcctgggacagaacacagatca
atgagtttcaaaaggtttgacctttctagccaagcatgcagttcagcagtagaatggagg
gtggtgcgtgccccatcacggcttgctcttctccccagcccctgcccctctgggatatcc
tggggacactcagctaacctctctgtctcttcctctttgtctgtgtctgtctccctctct
ctccccttctcttcccctcttctctcccttccatcctctgggtgtgtgtcctctgatact
ggcctttgtctcctgtctgtccatctgcctctctctgtgcctgtctccctcgtcgtacct
gccttgttctctccaaaggaccctccagtggacatgggtggggccctgggtctggctctg
ctgctcacctcaatcctgggtgcctggtcagggctgggcccaggtcagggccaacaggct
gtgacggtggctgtggtgtttggcagctcagggccaccccaggcccaggctcgtgcccac
ttcaccccccagagcttcctggacctgcccctggagatccagccctcacgagggggggtc
aacaacaccgaccccacagcctcctcaccagatctgtggctcctgggcgctgcccgcgtc
cacgggatcgactttgaggagaagagaggcgcgaggtggggccagatcttcgacttcctc
tcctcccagacccactggggaggcagaggcagggggcggggcactggacaccctgcttct
ctccctcctcccaggcatctgctgaatgtcacctgggagggccgagacttctccttcagc
cctggtgggtacctggtccagcccaccatggttgtgatagctctcaaccggcaccgcctc
tgggagatggtnnnnnnctgggagcatggcgtcctgcacatgaagtacccagtgtggcct
tgatacagtgcctctctgcagcccgtggtggacagccggcacctgacagtggccacgctg
gaagagcggccctttgtcattgtggagagccccgactctggcaccggcggctgcgtgccc
aacaccgtgccctgccgcagacagaacaatcacaccttcagtggagatgcagccccctac
accaagctgtgctgtaagggcttctgcatcgacatcctcaagaagctggccaaggtggtc
aagttctcctacgacctgtacctggtgaccaatggcaagcatggaaagagggtgcgcggc
gtgtggaacggcatgattggggaggtgtactacaagcgggcagacatggccatcggctcc
ctcaccatcaatgaggagcgctcggagatcgtggacttctctgtgcccttcgtggagacg
ggcatcagcgtcatggtggctcgcagcaatggcactgtctccccctcagccttcctggag
ccctacagcccctcggtgtgggtgatgatgttcgtcatgtgcctcaccgtggtggccatc
accgtcttcatgttcgagtacttcagccccgtcagctacaaccagaaccttgccagcggg
aagaagtctgggggcccatctttcaccattggcaagtccgtgtggctactgtgggcgctg
gtcttcaacaactcggtgcccatcgagaatccccggggcaccaccagcaaaatcatggtc
ctggtctgggccttctttgccgtcatcttcctcgccagctacactgccaacctggctgcc
ttcatgatccaagagcagtacattgacactgtgtctggtctcagtgacaagaaggttctg
gagccatagtacccgcccttccgctttggcaccgtgcccattggcagcaccgagcggaac
atccgcagcaactaccgtgacatgcacacccacatggtcaagttcaaccagcgctcggtg
gaggacgcactcacaagcctcaagatggggaagctggatgccttcatctacgacgccgct
gtcctcaactacatggcaggcaaggatgaaggctgcaagctggtcaccattgggtctggc
aaggtctttgccaccactggctacggcatcgccatgcagaaggactcccattggaagcgg
cccctagacctggcactcctgcagttcctgggtgacggggagacacagaagctggagacg
gtgtggctctcagggatctgccagaatgagaagaatgaggtgatgagcagcaagctggac
atcgacaacatggcgggtgtcttctacatgctgctcgtggccatggggctggccctgctg
gtctttgcctgggagcacctggtgtactggaagctgcgacattcaatgccccacacgtcc
cagctggacttcctgctggctttcagtaggggcatctacagtttgcttcagcgggcgtgc
aggagcctggccaggccccgggcgggcggcccagcccggagctcacggccgggtctggcc
caggccaacgtgctcaagatgctgcggccggcgcgcaacatggtgacaacggctggcgtg
ggcagctccctggaccgcgccacgcgcaccatcgagaactgggccaaccgtcgcgcgccc
ccgacgcccgccgcgcactctccgaccccccgcccgccccctgagcccagtcccaaggcc
tgggggccgtccggtggcggctgcgcagtcctggtgcaccggacccagcagccaccagtt
cgccccccgacgcccgcgccgtctctgcccaacgacccccggacgcttgggcggccggcc
tgggacacccggcggctagcgcgggccgggcgcggcaggtggcacctctcgtcctccgag
cggcgcgcaccgccggagagccccctgtcccctgcgcgctgttcctacaactccttcccg
cgaggcgaccgggcggggcgccccttcctcccgctcttcccggagcctccggagcccgag
aacttgccgctgcttgggcgggagcagctggcccggcgggaggctctgttgcacgcggcc
tgggcccgcagtccccgtccgcgccacgcctccctgcccagttcggtggcggcagccttc
gctcggcccaggtcgcaatctgccgcgtgcgcaggtcctacctgcgcctgccgtgacgcc
cgcctggcctggaggctcccggcgccgtcgctccggctgccgtcctaccgcgaggcgtgc
cgggggggcatgcgggaagggacccccacctggccgcacggacagcacgcctgcctccac
gcccatgcccacctaccgctctgttggggcgctgtctgctctcatcgcccacactgtgcc
agacatggcccgtggttccctggagcctgggggcctcaggggcacgggggcaggaccgtg
gggctgagcacaggctacagggacagtggggggctggatgaggtcagcagtgtggcctgt
gaaatgcatggcctttcaagcccttgcacatggaggcggttctccagcctggagtcggaa
gtgtga

KEGG   Loxodonta africana (African savanna elephant): 100660738
Entry
100660738         CDS       T04351                                 

Gene name
GRIN2B
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor ionotropic, NMDA 2B
  KO
K05210  glutamate receptor ionotropic, NMDA 2B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04724  Glutamatergic synapse
lav04728  Dopaminergic synapse
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05033  Nicotine addiction
lav05034  Alcoholism
lav05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100660738 (GRIN2B)
   04015 Rap1 signaling pathway
    100660738 (GRIN2B)
   04024 cAMP signaling pathway
    100660738 (GRIN2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100660738 (GRIN2B)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100660738 (GRIN2B)
   04728 Dopaminergic synapse
    100660738 (GRIN2B)
   04720 Long-term potentiation
    100660738 (GRIN2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100660738 (GRIN2B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100660738 (GRIN2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100660738 (GRIN2B)
   05014 Amyotrophic lateral sclerosis
    100660738 (GRIN2B)
   05016 Huntington disease
    100660738 (GRIN2B)
   05017 Spinocerebellar ataxia
    100660738 (GRIN2B)
   05020 Prion disease
    100660738 (GRIN2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100660738 (GRIN2B)
  09165 Substance dependence
   05030 Cocaine addiction
    100660738 (GRIN2B)
   05031 Amphetamine addiction
    100660738 (GRIN2B)
   05033 Nicotine addiction
    100660738 (GRIN2B)
   05034 Alcoholism
    100660738 (GRIN2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100660738 (GRIN2B)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100660738 (GRIN2B)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan-Glu_bd Lig_chan SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 100660738
NCBI-ProteinID: XP_023409909
LinkDB
Position
Unknown
AA seq 1456 aa
MKPRAECCSPKFWLVLAVLAVSGSRARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLETRHPMLTFCPCLLVMPEPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKG
TTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGT
VPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVLNYMAGRDEG
CKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEK
NEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFRHCFMGVCSGKPGMVFSIS
RGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMANLSGVNGSPQSALDFI
RRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERTFGNLQLKDSNVYQDHY
HNHHRPHSIGSTSSMXXXXXXXXXXXXXXXXXXXXXXXHLAXPSSKHSQLSDLYGKFSFK
SDRYSGHDDLIRSDVSDISTHTVXYGNIEGNAAKRRKQQYKDSLKKRPASAKSRREFDEI
ELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERGDDFKRD
SVSGGGPCTNRSHLKGDKHSVVSGVPAPWEKNLTNMDWEDRSGGNFCRSCPSKLHNYSTT
VAGQNSGRQACIRCEACKKAGNLYDISEDNSLQELDQPAAPVAVTSNASTTKYPQSPTNS
KAQKKTRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFLDGSPYAHMFEMPAGEST
FANNKSSVPTAGHHHHNNPGSSYMLSKSLYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQ
PTVAGAPKARPDFRALVTNKPVVSALHGAVPGRFQKDICIGNQSNPCVPNNKNPRAFNGS
SNGHVYEKLSSIESDV
NT seq 4371 nt   +upstreamnt  +downstreamnt
atgaagcccagagcagagtgctgttctcccaagttctggttggtgttggctgtcctggcc
gtgtcaggcagcagagcgcgttctcagaagagcccccccagcattggcattgctgtgatc
cttgtgggcacttcagacgaagtggctatcaaggatgctcacgagaaagatgactttcac
catctctccgtggtgccccgtgtggagctggtagccatgaacgagactgacccaaagagc
atcatcacccgcatctgcgatctcatgtctgaccggaagatccagggtgtggtgtttgct
gacgacacagaccaggaagccattgcccagatcctcgatttcatttcagcccagactctt
acccctatcctgggcatccacgggggctcatctatgattatggcagataaggatgaatcc
tctatgttcttccagtttggcccatcaattgaacagcaagcttctgtaatgctgaacatc
atggaggagtatgactggtacatcttttctattgtcaccacctacttccctggctaccag
gactttgtaaacaagattcgcagcaccatcgaaaatagcttcgtgggctgggagttagag
gaagttctcctgctggatatgtccctggatgatggagattctaagatccagaaccagctc
aagaaactccaaagccccatcattctcctttattgtactaaggaagaagccacctacatc
tttgaagtagcaaactcagtagggctaactggctatggctatacgtggattgtgccaagc
ctggtggcaggggatacagacacagtgccctcggagttccccactgggctcatctctgta
tcatatgatgagtgggactatggcctccctgccagagtaagggatggaattgccataatc
accactgctgcttctgacatgctctccgaacacagcttcatccccgaaccgaagagcagt
tgttacaacactcatgagaagagaatctaccagtccaatatgctaaataggtatctgatc
aatgtcacttttgaagggaggaatctgtccttcagtgaagatggctaccagatgcacccg
aaactggtgataattcttctgaacaaggagaggaagtgggagagggtggggaagtggaaa
gacaaatccctgcagatgaagtactacgtgtggccccgaatgtgccctgagacagaagag
caggaagatgaccacctgagcattgtgaccctggaagaggctccgtttgtcattgtggaa
agtgtggaccctctgagtggaacctgcatgaggaacacagttccctgccaaaaacgcatc
atctctgagaataaaacagatgaggagccaggttacatcaaaaaatgctgcaaggggttc
tgtatcgacattcttaagaaaatttctaaatctgtgaagttcacctatgacctttacttg
gttaccaatggcaagcatgggaagaaaatcaatggaacctggaatggtatgattggagag
gtggtcatgaagagggcttacatggcagtggggtcactcaccatcaatgaggagaggtct
gaggtggtcgacttctctgtgccctttatagagacaggcatcagtgttatggtgtcacga
agtaacgggacggtctcaccttctgccttcttagaaaccaggcaccctatgttaactttc
tgtccttgtcttttggtcatgccagagccaggtggcccatctttcaccatcggcaaagct
atttggttactctggggtctggtgtttaacaactccgtgcctgtgcagaacccaaagggg
accacctccaagattatggtgtcagtgtgggccttctttgctgtcatcttcctggccagc
tacactgccaacttagctgccttcatgatccaagaagagtacgtagaccaggtttccggc
ctgagtgacaaaaagttccagagacccaatgacttctcaccccctttccgctttgggact
gtgcccaatggcagcacagaaaggaatatccgcaataactatgcagaaatgcatgcctac
atgggaaagttcaaccagaggggagtagatgatgccttgctctccctgaaaacagggaaa
ctggatgccttcatctatgatgcagcagtgctgaactacatggcaggtcgagatgaaggc
tgcaagctcgtgactattggcagcgggaaagtctttgcttccactggctatggcattgcc
atccaaaaggattctgggtggaagcgccaggtggatcttgctatcttgcagctctttggc
gatggggagatggaagagctggaagctctctggctcactggcatttgccacaacgagaag
aatgaggtcatgagcagccagctggacattgacaacatggcaggagtcttctacatgttg
ggggcagccatggctctcagcctcatcaccttcatctgcgaacaccttttctattggcag
ttccggcactgctttatgggtgtctgttctggcaagcctggcatggtcttctccatcagc
agaggtatctacagctgcatccatggagtggctatcgaggagcgccaatcagtgatgaat
tcccccaccgcaaccatgaacaacacacactccaacatcctgcgcctgctccgcacagcc
aagaacatggctaacttgtctggtgtcaatggctccccacagagcgccctggacttcatc
cgacgcgagtcatctgtctatgacatctccgagcaccgccgcagcttcacacattccgac
tgcaaatcctacaacaacccaccctgcgaggagaaccttttcagtgactatatcagtgag
gtggagagaacttttggtaacctacagctgaaggacagcaacgtgtaccaagatcactat
cacaatcaccaccggccccacagcattggcagtaccagctccatgannnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngacatttg
gcctagccttcctccaaacacagccagttaagtgacctgtacggcaagttctccttcaag
agcgaccgctacagtggccatgatgacttgatccgctccgatgtctctgacatctccacc
cacactgtcnactatggaaacattgagggcaatgctgccaaaaggcgtaagcagcaatat
aaggacagcctgaagaagcggccagcctcggccaagtcccgacgggaattcgatgagatc
gagctggcctatcgccgccgaccaccccgctcccctgatcacaagcgctacttcagggac
aaggaagggctacgggatttctacctggaccagttccgaacaaaggagaactcacctcat
tgggagcatgtggacctgacggatatctacaaggaacggggtgatgactttaagcgcgac
tcagttagtggtggaggaccctgtaccaacaggtcacacctcaagggtgacaaacacagt
gtggtcagtggggtgccagcaccttgggagaagaacctgaccaacatggattgggaagac
cgatctgggggcaacttctgccgcagctgcccctcgaagctgcacaactactccaccacg
gtggcaggacagaactcgggcaggcaggcatgcatccggtgtgaggcttgcaagaaggca
ggtaacctgtatgacatcagcgaggacaactccctgcaggagctggaccagccagctgcc
cccgtggcagtgacgtcaaatgcctccaccaccaagtatcctcagagcccaactaattcc
aaggcccagaagaagacccggaacaaactgcgccggcagcactcctatgacaccttcgtg
gacctgcagaaggaagaagccgccttggccccgcgcagcgtgagcctgaaagacaagggt
cgtttcctggatgggagtccctatgcccacatgtttgagatgccagctggtgagagcacg
tttgccaacaacaagtcctcagtgcccactgccggacaccaccaccacaacaaccccggc
agcagctacatgctcagcaagtcgctctatcctgaccgggtcacgcaaaaccctttcatc
cccacttttggggatgaccagtgcttgctccatggcagcaaatcctacttcttcaggcag
cccacggtggcgggggcaccgaaagccaggccagacttccgggcccttgtcaccaacaag
ccggtggtctcggcccttcatggggctgtaccaggccgtttccagaaggacatctgtata
gggaaccagtccaatccctgtgtgcctaacaacaaaaaccccagggctttcaatggctcc
agcaatgggcatgtttatgagaaactttctagtattgagtctgatgtctga

KEGG   Loxodonta africana (African savanna elephant): 100663779
Entry
100663779         CDS       T04351                                 

Gene name
GRIN1
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 1
  KO
K05208  glutamate receptor ionotropic, NMDA 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04724  Glutamatergic synapse
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05033  Nicotine addiction
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100663779 (GRIN1)
   04015 Rap1 signaling pathway
    100663779 (GRIN1)
   04020 Calcium signaling pathway
    100663779 (GRIN1)
   04024 cAMP signaling pathway
    100663779 (GRIN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100663779 (GRIN1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100663779 (GRIN1)
   04720 Long-term potentiation
    100663779 (GRIN1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100663779 (GRIN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100663779 (GRIN1)
   05014 Amyotrophic lateral sclerosis
    100663779 (GRIN1)
   05016 Huntington disease
    100663779 (GRIN1)
   05017 Spinocerebellar ataxia
    100663779 (GRIN1)
   05020 Prion disease
    100663779 (GRIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100663779 (GRIN1)
  09165 Substance dependence
   05030 Cocaine addiction
    100663779 (GRIN1)
   05031 Amphetamine addiction
    100663779 (GRIN1)
   05033 Nicotine addiction
    100663779 (GRIN1)
   05034 Alcoholism
    100663779 (GRIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100663779 (GRIN1)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100663779 (GRIN1)
SSDB
Motif
Pfam: ANF_receptor
Other DBs
NCBI-GeneID: 100663779
NCBI-ProteinID: XP_023398181
LinkDB
Position
Unknown
AA seq 347 aa
MSTMSLLTLALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRL
ETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQFDPGTKNVTALLMEARELEARVI
ILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESA
HISDAVGVVAQAVHELLDLGERNITAGLRGQRQHQHLEDRGPSFRGC
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgagcaccatgagcctactgaccctcgccctgcttttctcctgctccttcgcccgtgct
gcttgcgaccccaagatcgtcaacatcggcgccgtgctgagcacgcggaaacatgagcaa
atgttccgcgaggcggtgaaccaggccaacaagcggcacggctcctggaagatccagctc
aatgccacctccgtcactcacaagcccaacgccatccagatggccctgtccgtgtgcgag
gacctcatctccagccaggtctatgccatcttagttagccaccctcctacccccaacgac
cactttactcccactcccgtctcctacactgctggcttctaccgtatccctgtcctgggg
ctgaccacccgcatgtccatctactcggacaagagcatccacctgagcttcctgcgcacc
gtgccgccctactcccaccagtccagcgtctggttcgagatgatgcgcgtctataactgg
aaccacatcatcctgctcgtcagcgacgaccacgagggccgggcggcgcagaagcgcctg
gagacgctgctggaggagcgcgagtccaagagtaaaaaaaggaactatgaaaacctcgac
caactgtcctatgacaacaagcgcggacccaaggctgagaaggtgttgcagtttgaccct
ggcaccaagaacgtgacggccctgctgatggaggcacgggagctggaggcacgggtcatc
atcctctcggccagcgaggacgatgctgccaccgtgtaccgtgcagccgcgatgctgaac
atgacgggctcggggtacgtgtggctggtgggcgaacgcgagatctcggggaacgccctg
cgctacgcaccagacggcatcatcgggctgcagctcatcaacggcaaaaacgagtcagcg
cacatcagcgacgccgtgggcgtggtggcgcaggccgtgcacgagctcctggacctggga
gaaagaaacatcaccgcggggctgcgtgggcaacgccaacaccaacatctggaagaccgg
ggcccctctttcagagggtgctga

KEGG   Loxodonta africana (African savanna elephant): 100668524
Entry
100668524         CDS       T04351                                 

Gene name
GRIN3A
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 3A
  KO
K05213  glutamate receptor ionotropic, NMDA 3A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04724  Glutamatergic synapse
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05033  Nicotine addiction
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100668524 (GRIN3A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100668524 (GRIN3A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100668524 (GRIN3A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100668524 (GRIN3A)
   05020 Prion disease
    100668524 (GRIN3A)
  09165 Substance dependence
   05030 Cocaine addiction
    100668524 (GRIN3A)
   05031 Amphetamine addiction
    100668524 (GRIN3A)
   05033 Nicotine addiction
    100668524 (GRIN3A)
   05034 Alcoholism
    100668524 (GRIN3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100668524 (GRIN3A)
Ion channels [BR:lav04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100668524 (GRIN3A)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor DUF5446
Other DBs
NCBI-GeneID: 100668524
NCBI-ProteinID: XP_003407875
LinkDB
Position
Unknown
AA seq 1104 aa
MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
ASGAASRAPDGSRAGAQRDEPGPGTWRPPAPSPGARWLGSALHGRGPPGARKPVESSAAD
TLWPRDALLFAMDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSQGEMLELDLVSSVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSVITITAN
LSSTEDLLSFLQVQLESIKNSTPTMVMFGCHMESIRRIFQITTHFGVTLPELHWVLGDSQ
NVEELRTEGLPVGLIAHGRTTQFVFEYYVQDAMELVARAVATATMIQPELALIPSTMNCM
DVETANLTSGQYLSRFLANTTFRGLSGSIKVKGSTIISSENNFFIWNLQHDPMGKPMWTR
LGSWQRGKIVMDYGIWPEQAKRHKTHLQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLNPMTNDSFVLDSLFSSLHSSNDTVPTRFKKCCYGYCIDLLEKLAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLSGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTTAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRSKVFSFSSAL
NVCYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPTTPHGVENLKNDAEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAMEGYGIGLPPNSPLTSNISDLISQYKSHGFM
DVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLKYWLHTSQRLHRALNTSFVEEKQQCFKTKRVERRSNMGPHQLAVWNTSNPS
LDNRCKYILNDEGGQNQVGLQIHQDIPLPPMTTNGKADSLNVARNSVMQELSELEKQIQV
IRQELQLAVSRKTELEEYQRTNRT
NT seq 3315 nt   +upstreamnt  +downstreamnt
atgaggagactgagtttgtggtggttgctgagcagggtctgtctgttactgccgccgccc
tgcgcgctggtgctggccggggtgcccagctcctcctcgcacccgcagccctgccaaatc
ctcaagcgcatcgggcacgcggtgagggtgggcgcagtgcacctgcagccctggaccacg
gcctctggcgctgccagccgcgctccggacggcagccgggcaggcgcccagcgggatgag
cccgggccggggacttggcggcccccggcaccctcgcctggcgcacgctggttggggagc
gccctgcatggccgggggccgccgggggcccgaaagcccgtggagagctccgccgccgac
accctgtggccgcgagacgccctcctcttcgctatggacaacctgaaccgcgtggaggga
ctgctgccctacaacctgtctttagaagtcgtgatggccatcgaggcgggcctgggcgat
ctaccgctcttgcccttctcctcccctagctctccttggagcagtgaccctttctccttt
ctgcaaagcgtgtgccacaccgtggtggtgcaaggggtatctgcgctgctggccttcccc
cagagccaaggcgagatgctggagctcgacttggtcagctctgtcctgcacatcccagtc
atcagcatcgtgcgccacgagtttccgcgggagagtcagaatccccttcacctacaactg
agtttagaaaattcattaagttctgatgctgatgtcactgtctcaatcctgaccatgaac
aactggtacaattttagcttgttgctgtgccaggaagactggaacatcaccgacttcctc
ctccttacccagaataattccaagtttcaccttggctctgtcatcaccatcaccgccaac
ctctcctccaccgaggacctcttgagcttcctgcaggtgcagcttgaaagcattaagaac
agcacacccacaatggtgatgtttggctgccacatggaaagtatccggcggattttccaa
atcaccacccactttggggtaacactccctgagctccactgggtgctgggggattcccag
aatgtggaggaactgaggacagaaggtctgcccgtaggactcattgctcatggaagaaca
acacagtttgtctttgagtactacgtacaggatgccatggagctggttgcaagagctgta
gccacagccacaatgatccagccagagcttgctctcattcccagcacgatgaactgcatg
gacgtggaaactgcaaatctcacgtcaggacaatatttatcaaggtttctagccaacacc
actttcagaggcctcagtggttccatcaaagtaaaaggttccaccatcatcagctcagaa
aacaactttttcatctggaatctgcaacatgaccccatgggaaagcctatgtggactcgc
ttgggcagctggcagcgggggaagattgtcatggactatgggatatggccagagcaggcc
aagaggcacaaaacccacttacaacacccaagtaagctacacctgagagtggttaccctg
attgagcacccatttgtcttcacacgggaggtagatgatgaaggcttgtgccctgctgga
caactctgtctaaacccaatgactaatgactcattcgtattagacagcctttttagtagc
ctccatagcagtaatgatacagtgcccaccagattcaagaagtgctgttatggatattgc
attgatctactggaaaagctagcagaagacatgaactttgactttgacctctatattgtt
ggggatggaaagtatggagcctggaaaaatgggcactggactgggctggtgggtgacctt
ctgagtggaacagcccacatggcagtcacttccttcagcatcaatactgcacgaagccag
gtgatagatttcaccagccctttcttctccaccagcttgggcatcttagtgaggacccga
gacacaacagctcccattggagccttcatgtggccactacactggacaatgtggctgggg
atttttgtggctctgcacatcactgccatcttcctcactctatatgaatggaagagccct
tttggtatgactcccaagggacggaatagaagtaaagttttctccttctcttcagccttg
aatgtctgttatgctctcttgtttggcagaacagtggccatcaaacctccaaaatgctgg
actggaaggtttctaatgaacctctgggccattttctgtatgttttgcctttccacatac
acggcaaacttggctgctgtcatggtaggtgagaagatctatgaagagctttctggaata
catgaccctaagctccatcatccctcccaaggtttccgctttggaactgtccgggaaagc
agtgctgaagattacgtgaggcaaagtttcccagagatgcatgagtatatgagaaggtac
aatgtaccaaccacccctcatggagtagagaatctgaagaatgatgcagagaaactggac
gccttcatcatggacaaagcccttctggattatgaagtgtcaatagatgctgactgcaaa
cttctaactgtggggaagccatttgccatggaaggatatggcattggtctcccacccaac
tctccactgacctccaatatatctgatctaatcagtcaatacaaatcacatgggtttatg
gatgtgctacatgacaaatggtacaaggtcgttccctgtggcaagagaagtttcgctgtc
actgagactttgcagatgggcatcaaacacttctctggactcttcgtgctgctgtgcatt
ggatttgggttgtccatcttgacaaccattggtgagcacatagtgtacaggctgctgcta
ccacgaatcaaaaataaatccaagctgaaatactggctccacaccagccagagattacat
agagcactaaacacatccttcgtagaggaaaagcagcagtgcttcaagacgaaacgtgtg
gaaaggaggtccaacatgggaccccatcagcttgccgtgtggaatacttccaatccgagt
cttgacaaccggtgcaaatacatcttgaatgatgagggaggccaaaaccaggtgggcctc
cagatccaccaggacatccctctccctccaatgaccaccaatgggaaagcagattccctc
aatgtagcgcggaactcagtgatgcaggaactctcggagctggagaagcagatccaggtg
atccgccaggagctgcagctggctgtgagcaggaagacagagctagaagaatatcaaagg
acaaaccggacttag

DBGET integrated database retrieval system