KEGG   Loxodonta africana (African savanna elephant): 100653551
Entry
100653551         CDS       T04351                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100653551 (WNT2B)
   04390 Hippo signaling pathway
    100653551 (WNT2B)
   04150 mTOR signaling pathway
    100653551 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100653551 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100653551 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100653551 (WNT2B)
   05205 Proteoglycans in cancer
    100653551 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100653551 (WNT2B)
   05226 Gastric cancer
    100653551 (WNT2B)
   05217 Basal cell carcinoma
    100653551 (WNT2B)
   05224 Breast cancer
    100653551 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100653551 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100653551 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100653551 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100653551 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100653551 (WNT2B)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100653551 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100653551
NCBI-ProteinID: XP_003409631
UniProt: G3TMD4
LinkDB
Position
Unknown
AA seq 387 aa
MLRPGGAQDAAQLPLWRARAPVPAPPDGCRPPARLGLACLLLLLLLTLPAPVDTSWWYIG
ALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRD
HTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHRDQRGDFD
WGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSG
SCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTDLVYFDN
SPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCA
VRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgctgaggccgggtggtgcgcaggacgccgcgcagctccccctttggcgcgctcgcgcc
cctgtcccggcgccccccgacggctgccggcctccggcccgcctaggtcttgcctgcctt
ctgctgctgctgctgctgacgctgccggcccctgtagacacgtcctggtggtacattggg
gcactgggagcccgggtgatctgtgacaatatccctggtctggtgagccggcagcggcag
ctgtgccagcgttacccagacatcatgcgctcggtgggcgagggtgcccgagaatggatc
cgggaatgtcagcaccagttccgccaccaccgctggaattgcaccacactggacagggat
cacacggtctttggacgtgtcatgctcagaagcagccgggaggcagcatttgtgtatgcc
atctcatcagcaggggtggtccacgctatcactcgtgcctgtagtcagggtgaactgagt
gtgtgcagctgtgacccctacacccgtggccgacaccgtgaccaacgtggggactttgac
tggggtggctgcagtgacaacatccactatggtgtccgctttgccaaggcctttgtggat
gccaaggagaagaggcttaaggatgcccgggccctgatgaacttacacaacaaccgctgt
ggtcgcacggctgtgcggcggtttctgaagctagagtgtaagtgccacggggtgagtggc
tcctgtactctgcgtacctgctggcgtgcactctcagacttccgccgcacaggtgattac
ctgaggcgacgctatgatggggctgtgcaggtgacagccacccaggatggcgccaacttc
acagcagcccgccaaggctatcgacgtgccactcggactgaccttgtctacttcgacaac
tccccagactattgtgtcttggacaaggctgcaggttccctaggcactgcaggccgtgtc
tgcagcaagacctctaaagggacagacggttgtgaaatcatgtgctgtggccgagggtat
gacacaactcgagtcacccgtgtcacccagtgtgagtgcaaattccactggtgctgtgct
gtgcggtgcaaggagtgcaggaacactgtggacgtccatacttgcaaggcccccaagaag
gcagagtggctggaccagacctga

KEGG   Loxodonta africana (African savanna elephant): 100655805
Entry
100655805         CDS       T04351                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100655805 (WNT10B)
   04390 Hippo signaling pathway
    100655805 (WNT10B)
   04150 mTOR signaling pathway
    100655805 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100655805 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100655805 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655805 (WNT10B)
   05205 Proteoglycans in cancer
    100655805 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100655805 (WNT10B)
   05226 Gastric cancer
    100655805 (WNT10B)
   05217 Basal cell carcinoma
    100655805 (WNT10B)
   05224 Breast cancer
    100655805 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100655805 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    100655805 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100655805 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100655805 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100655805 (WNT10B)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100655805 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100655805
NCBI-ProteinID: XP_023411682
LinkDB
Position
Unknown
AA seq 389 aa
MPEEPRPRPPPSGLSGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSSEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSGSSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMQIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRVVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTVGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgccggaggagccccggccgcggcctccgccctcgggcctctctggcctcctgttcctt
gcgctgtgcagtcgggccctcagcaatgagattctgggcctgaagctgccaggcgaaccg
ccgctgacggccaacaccgtgtgcttgacgctgtcgggcctgagcaagaggcagctgggc
ctgtgcctgcgcagccccgacgtgacggcgtcagcgctgcaggggctgcacatcgcggtc
cacgagtgtcagcaccaactgcgggaccagcgctggaactgctcggcgctcgagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgtgagagtgccttttcc
ttctccatgctggctgcaggtgtcatgcacgctgtagccacggcctgtagcctgggcaag
ctggtgagctgtggctgcggctggaagggcagcagtgagcaggatcggctgagggccaaa
ctgctgcagctgcaggcactgtcccggggcaagagcttccctcactctctgcccagccct
ggtcctggctcaggctccagccctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcctggattccagagaagctccc
cgggacattcaggcacgaatgcagatccacaacaacagagtggggcgccaggtggtaact
gaaaacctgaagcggaaatgcaagtgccatggcacatcaggcagctgccagttcaagaca
tgctggagggccgccccagagttccgggtagtaggggcagcgctgagggagcggctgggc
cgggccatcttcatcgatacccacaaccgaaactcaggagccttccaaccccgcttgcgt
cctcgtcgcctctcaggagagctggtctactttgagaagtctcctgacttctgtgaaaga
gaccccactgtgggctccccagggacaaggggccgggcctgcaacaagaccagccgccta
ctggatggctgtggcagcctgtgctgtggccgtgggcacaatgtgctccggcagacacga
gttgagcgttgccactgccgcttccactggtgctgctatgtgctttgtgatgagtgcaag
gtcacagaatgggtcaacgtgtgcaagtga

KEGG   Loxodonta africana (African savanna elephant): 100656630
Entry
100656630         CDS       T04351                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100656630 (WNT11)
   04390 Hippo signaling pathway
    100656630 (WNT11)
   04150 mTOR signaling pathway
    100656630 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100656630 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100656630 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656630 (WNT11)
   05205 Proteoglycans in cancer
    100656630 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100656630 (WNT11)
   05226 Gastric cancer
    100656630 (WNT11)
   05217 Basal cell carcinoma
    100656630 (WNT11)
   05224 Breast cancer
    100656630 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100656630 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    100656630 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100656630 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100656630 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100656630 (WNT11)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100656630 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100656630
NCBI-ProteinID: XP_023394805
LinkDB
Position
Unknown
AA seq 369 aa
SSNKGPQRPLRRRLGPIGQVKATSPLTALSLSSHRLLSLGLCRALSKTPAALVLNQTQHC
KQLEGLVSAQVQLCRSNLELMRTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLE
RGTRESAFVYALSAAAISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGL
LMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEVKCKCHGVSGSCSIRTCWK
GLQELRDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMK
NEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRKCE
RIVERYVCK
NT seq 1110 nt   +upstreamnt  +downstreamnt
tcttccaacaaaggcccgcagagaccattgcggagaaggctgggaccaatagggcaggtg
aaggcaacgtcgcctctcacagccctttctctttcctcccaccggttgctgtccttgggg
ctgtgtagggcgctgtccaagacgccggcggctctggtgctgaaccagacgcagcactgc
aagcagctggagggcctggtgtctgcccaggtgcagctgtgccgcagcaacctggaactc
atgcgcaccattgtgcacgctgcccgcgaggtcatgaaggcttgccgcagggccttcgca
gacatgcgctggaactgctcctccatcgagctcgcccccaactacctgcttgacctggag
agagggacccgggagtcggccttcgtgtatgcgctgtcggcggccgccatcagccacgcc
atcgcccgggcctgcacctccggcgacctgcccggctgctcctgcggccccgtcccaggt
gagccacccgggcccgggaaccgctggggaggatgtgcggacaacctcagctacgggctc
ctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaaacaggatcccaagcc
aataaactgatgcgtctacacaacagtgaagtggggagacaggctctccgtgcctctctg
gaagtgaagtgtaagtgccatggggtgtctggctcctgctccatccgcacctgctggaag
gggctgcaggagctgcgggatgtggctgctgacctcaagacccgctacttgtcggccacc
aaggtagtgcaccgacccatgggcacccgcaagcacctggtgcccaaggacctggatatc
cgacctgtgaaggactcggagctcgtctatttgcagagctcacctgacttctgcatgaag
aacgagaaggtgggctcccacgggacacaggacaggcagtgcaacaagacatccaatgga
agtgacagctgtgacctcatgtgctgtgggcgcggctacaacccctacacagaccgcgtg
gtcgagcggtgccactgcaagtatcactggtgctgctatgtcacctgccgcaagtgtgag
cgcatcgtggagcgctacgtctgcaagtga

KEGG   Loxodonta africana (African savanna elephant): 100657046
Entry
100657046         CDS       T04351                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100657046 (WNT2)
   04390 Hippo signaling pathway
    100657046 (WNT2)
   04150 mTOR signaling pathway
    100657046 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100657046 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100657046 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657046 (WNT2)
   05205 Proteoglycans in cancer
    100657046 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100657046 (WNT2)
   05226 Gastric cancer
    100657046 (WNT2)
   05217 Basal cell carcinoma
    100657046 (WNT2)
   05224 Breast cancer
    100657046 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657046 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    100657046 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100657046 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100657046 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100657046 (WNT2)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100657046 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100657046
NCBI-ProteinID: XP_003407280
UniProt: Q108U2
LinkDB
Position
Unknown
AA seq 360 aa
MNAPLAGIWPWLPLLLTWLAPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDSKGTFDWGGCSDNIDYGIRFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSPGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSRITRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWAAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctctcgccggaatctggccctggctccctctgctcttgacctggctcgcc
cccgaggtcagctcttcatggtggtacatgagagctacaggcggctcctccagggtgatg
tgtgacaatgtgccaggcttggtgagccgccagcggcagctgtgccaccgacacccggat
gtgatgcgtgccattggcctaggggtggccgagtggacggcagagtgccagcatcagttc
cgccagcaccgctggaactgcaacaccctagacagggatcacagcctctttggcagggtg
ctgctccgaagtagtcgggaatctgcctttgtttacgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagagttaaaatcctgttcctgtgatccaaag
aagaagggaactgccaaggacagcaagggcactttcgattggggtggctgcagtgataac
attgactatgggatcagatttgcccgcgcatttgtggatgccaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagccgggaggaaggcggtcaagcgg
ttcttgaaacaagagtgcaagtgtcatggtgtgagtggctcatgtactctgaggacatgc
tggctggccatggccgacttcagaaaaaccggcgattatctctggaggaagtacaatggg
gccattcaggtcgtcatgaaccaggacggcactggtttcactgtggccaacaagaggttc
aagaagccaacaaaaaatgaccttgtgtactttgagaattctccagactactgtatcagg
gaccgagacgcaggctccccgggtacagcaggtcgagtgtgcaacctgacttcccgaggc
atggacagctgcgaagtcatgtgctgcgggagaggctacgacacctctcgcatcacccgg
atgaccaagtgcgagtgtaagttccactggtgctgcgccgtgcgctgtcaggactgcctg
gaggctctggatgtgcacacgtgcaaggcccccaagagcgccgactgggcagctcctaca
tga

KEGG   Loxodonta africana (African savanna elephant): 100658849
Entry
100658849         CDS       T04351                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100658849 (WNT5A)
   04390 Hippo signaling pathway
    100658849 (WNT5A)
   04150 mTOR signaling pathway
    100658849 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100658849 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100658849 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    100658849 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658849 (WNT5A)
   05205 Proteoglycans in cancer
    100658849 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100658849 (WNT5A)
   05226 Gastric cancer
    100658849 (WNT5A)
   05217 Basal cell carcinoma
    100658849 (WNT5A)
   05224 Breast cancer
    100658849 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100658849 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100658849 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100658849 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100658849 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100658849 (WNT5A)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100658849 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100658849
NCBI-ProteinID: XP_010588039
LinkDB
Position
Unknown
AA seq 380 aa
MKKSIAILSPGVALGMAGSAMSSKFFLMALAILFSVAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtcgattgcaatattaagcccaggagttgctttgggaatggctggcagtgca
atgtcttccaagttctttctaatggctttggccatattgttctccgtcgcccaggttgta
atagaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatatcataggagcgcagcctctctgcagccagctggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacattggagaaggcgcgaagacaggc
atcaaagaatgccagtatcaattccggcatcgaaggtggaactgcagcaccgtggataac
acctccgtttttggcagggttatgcagataggcagccgggagacggccttcacgtacgcg
gtgagcgccgcgggggtggtgaacgccatgagccgggcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctatggggc
ggctgcggcgacaacattgactacggctaccgcttcgccaaggagtttgtggacgcacga
gagcgggagcgcatccacgccaagggctcctacgagagtgcccgcatccttatgaacctg
cacaacaatgaagcgggccgcaggacggtgtacaacctggccgacgtggcctgcaagtgc
cacggggtgtccggctcctgcagcctcaagacgtgctggctgcagctggcagacttccgc
aaggtgggtgatgccctgaaggagaagtacgacagcgctgcggctatgcggctcaacagc
cggggcaagttggtgcaggtcaacagccgcttcaactcgcccaccacgcaggacctggtt
tacatcgaccccagccccgactactgcgtgcgcaatgagagcactggctcgctgggcacc
cagggccgcctgtgcaacaagacgtccgagggcatggatggctgtgagctcatgtgctgt
ggccgcgggtatgaccagttcaagacagtgcagacggagcgctgccactgtaagttccac
tggtgctgctacgtcaagtgcaagaagtgtacggagattgtggaccagttcgtgtgcaaa
tag

KEGG   Loxodonta africana (African savanna elephant): 100658979
Entry
100658979         CDS       T04351                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100658979 (WNT9B)
   04390 Hippo signaling pathway
    100658979 (WNT9B)
   04150 mTOR signaling pathway
    100658979 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100658979 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100658979 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658979 (WNT9B)
   05205 Proteoglycans in cancer
    100658979 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100658979 (WNT9B)
   05226 Gastric cancer
    100658979 (WNT9B)
   05217 Basal cell carcinoma
    100658979 (WNT9B)
   05224 Breast cancer
    100658979 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100658979 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    100658979 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100658979 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100658979 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100658979 (WNT9B)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100658979 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100658979
NCBI-ProteinID: XP_003414558
LinkDB
Position
Unknown
AA seq 355 aa
MVEDPSRKYGNKSGYLDYLDGNIILTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKLSR
RQKQMCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRSGLLKRGFKETAFLYAV
SSAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGPKRG
SKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQALKLRY
DSAVKVASATNEALGRLEVWAPTQPGSLAKGLVPRSMDLVYMEDSPSFCRPSKYSPGTAG
RVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggttgaagatccatctaggaaatacggaaacaagtcaggttacttagattacttggat
ggcaacataatcctgactgggcgggaggtcctgacgcccttcccagggctgggcaccgcg
gcagcccccgctcagggtggggctcacctgaagcagtgtgacctgctgaagctttcccgc
cgacagaagcagatgtgccggcgtgagccaggcctggctgagaccctgcgggatgctgcg
caccttggcctgcttgagtgccagttccagttccggcaggagcgctggaactgcagcctg
gaggggaggagcggcctgctcaagagaggtttcaaggagacggccttcctgtacgcggtg
tcctcggccgccctcacccacgcgctggcccgggcctgcagcgctgggcggatggagcgc
tgcacctgcgatgactccccaggcctggagagccggcaggcctggcagtggggtgtgtgt
ggcgacaacctcaagtacagcaccaagtttttgagcaacttcctggggcccaagcgagga
agcaaggacctgcgggcacgggccgatgcccacaacacccatgtgggcatcaaagcggtg
aagagtggcctcaggaccacatgtaagtgccacggtgtgtcaggctcctgtgctgtgcgc
acctgctggaagcagctgtccccgttccgagagacgggccaggcactgaaactgcgctat
gactctgctgtcaaggtagccagtgccaccaacgaggccctgggccgtctggaggtttgg
gcacccacccagccaggcagcctcgccaagggcctggtgccccggtccatggacctggtc
tacatggaggattcacccagcttctgccggcccagcaagtactcaccaggaacggctggc
agggtgtgctcccgggaggccagctgtagcagtctctgttgtgggcgcggctacgacact
cagagccgcctggtggccttctcctgccactgccaggtgcagtggtgctgctacgtagag
tgccagcagtgcgtgcaggaggagctggtgtacacctgcaagcactag

KEGG   Loxodonta africana (African savanna elephant): 100659037
Entry
100659037         CDS       T04351                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100659037 (WNT16)
   04390 Hippo signaling pathway
    100659037 (WNT16)
   04150 mTOR signaling pathway
    100659037 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100659037 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100659037 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659037 (WNT16)
   05202 Transcriptional misregulation in cancer
    100659037 (WNT16)
   05205 Proteoglycans in cancer
    100659037 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100659037 (WNT16)
   05226 Gastric cancer
    100659037 (WNT16)
   05217 Basal cell carcinoma
    100659037 (WNT16)
   05224 Breast cancer
    100659037 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100659037 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    100659037 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100659037 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100659037 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100659037 (WNT16)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100659037 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100659037
NCBI-ProteinID: XP_003407286
UniProt: G3T4U4
LinkDB
Position
Unknown
AA seq 363 aa
MDRAALLGLPRLCALWAALLALFPCGAQGNWMWLGIASFGVPEKLGCANLPLSSRQKELC
KRKPYLLPSIREGARLGVQECRNQFTHERWNCMVAAASAPSAASSVFGYELSSGTKETAF
IHAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRRF
LDSPIRNTTEKESQALLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVRTCWKTMSSF
EKIGHLLKDKYENSIQISDKIKKKMRRRDKDQRKIPIRKDDLVYVNKSPNYCVENKKLGI
PGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVH
TCK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggacagagcagcgctcctgggcctgccccgcctgtgcgcactgtgggcagccctgctc
gcgctgttcccctgcggagcccaaggaaactggatgtggctgggcatcgcctccttcggg
gttccggagaagctgggctgcgccaacttgccgctgagcagccgccagaaggagctgtgc
aagaggaagccgtacctgttgcccagcatccgcgagggcgcgcgcctgggcgtccaggag
tgcaggaaccagttcacgcacgagcgatggaactgcatggtcgccgccgcctccgccccg
tccgccgccagctcagtcttcggctacgagctgagcagcggcaccaaggaaacagcgttc
attcatgccgtgatggctgctggcctggtgcattctgtgacaaggtcgtgcagtgcaggc
aacatgacagaatgttcctgtgataccaccttgcagaacggcggctcggccagcgaaggc
tggcactgggggggctgctccgatgatgtccagtatggcatgtggttcagcagaaggttc
ctcgattcccccatcagaaacaccacggaaaaggaaagccaagctctgttagcaatgaac
ctgcataacaatgaagcgggaaggcaggctgttgccaagttgatgtccgtagactgccgc
tgccacggggtttcaggctcctgcgctgtgaggacatgctggaaaaccatgtcttctttc
gaaaagatcggtcatttgttgaaggacaaatatgaaaacagtatccaaatctcagacaaa
ataaagaagaaaatgcgcaggagagataaagaccagagaaaaataccgatccgcaaggat
gatctggtctatgttaataagtctcccaactactgtgtagagaataagaaactggggatc
ccagggacacaaggcagagaatgcaaccgcacgtcagagggcgccgatgggtgcaacctc
ctgtgctgtggccgaggctacaacactcacgtggtccggcacgtggaaaggtgtgagtgt
aagtttatctggtgctgctatgtccgatgcaggaggtgtgaaagcatgactgacgtccac
acctgcaagtaa

KEGG   Loxodonta africana (African savanna elephant): 100660629
Entry
100660629         CDS       T04351                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100660629 (WNT7B)
   04390 Hippo signaling pathway
    100660629 (WNT7B)
   04150 mTOR signaling pathway
    100660629 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100660629 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100660629 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100660629 (WNT7B)
   05205 Proteoglycans in cancer
    100660629 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100660629 (WNT7B)
   05226 Gastric cancer
    100660629 (WNT7B)
   05217 Basal cell carcinoma
    100660629 (WNT7B)
   05224 Breast cancer
    100660629 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100660629 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    100660629 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100660629 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100660629 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100660629 (WNT7B)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100660629 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100660629
NCBI-ProteinID: XP_010598759
UniProt: G3SNM2
LinkDB
Position
Unknown
AA seq 353 aa
MLLLSPRCALLSVYCPQIFLILSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP
DAIIVVGEGAQMGINECQHQFRFARWNCSALGERTVFGQELRVGSREAAFTYAITAAGVA
HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA
RRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV
QVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNR
TSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERAEVFTCK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctcctgctgtcgccgcgctgcgcgctgctctccgtctattgcccgcagatttttctc
atcctgtccagcggcagctacctagcgctgtcctccgtggtggccctgggagccaacatc
atctgcaacaagattcctggcctggccccgcggcagcgcgccatctgccagagccggcca
gacgccatcatcgtggtcggggagggggcgcagatgggcatcaacgagtgccagcaccag
ttccgcttcgcccgctggaactgctcggcgctgggcgagaggaccgtcttcggccaggag
ctccgagtaggaagccgtgaggccgccttcacgtacgccatcacggcggctggcgtggcc
catgctgtcaccgcggcctgcagccaaggcaacctgagcaactgcggctgcgaccgggag
aagcagggctactacaaccaggcagagggctggaagtggggcggctgctccgccgacgtg
cgctatggcatcgacttctcccggcgcttcgtggacgcccgtgagatcaagaagaacgca
cggcgcctcatgaatctgcacaacaacgaggctggcaggaaggtcctggaggagcgcatg
aagctggagtgcaagtgccatggcgtgtcgggctcgtgcaccaccaagacgtgctggacc
acactgcctaagttccgtgaggtgggccacctgctcaaggagaagtacaacgcggccgtg
caggtggaggtggtgcgcgccagccgcctgcggcagcccaccttcctgcgcatcaagcag
cttcgcagctaccagaagcccatggagaccgacctggtgtacatcgagaagtcgcccaac
tactgcgaggaggacgcggccacgggcagcgtgggcacccagggccgcctgtgcaaccgc
acctcgcccggagccgacggctgcgacaccatgtgctgcgggcgcggctacaacacgcac
cagtacaccaaggtctggcagtgtaactgcaaattccactggtgctgcttcgtcaagtgc
aacacgtgcagcgagcgcgccgaggtcttcacctgcaagtga

KEGG   Loxodonta africana (African savanna elephant): 100662057
Entry
100662057         CDS       T04351                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100662057 (WNT9A)
   04390 Hippo signaling pathway
    100662057 (WNT9A)
   04150 mTOR signaling pathway
    100662057 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100662057 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100662057 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662057 (WNT9A)
   05205 Proteoglycans in cancer
    100662057 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100662057 (WNT9A)
   05226 Gastric cancer
    100662057 (WNT9A)
   05217 Basal cell carcinoma
    100662057 (WNT9A)
   05224 Breast cancer
    100662057 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100662057 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    100662057 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100662057 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100662057 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100662057 (WNT9A)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100662057 (WNT9A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100662057
NCBI-ProteinID: XP_003421261
LinkDB
Position
Unknown
AA seq 639 aa
MASETPAFHPRFSATDAGEQLVAEVAVWVAGASRQEGRLSGRMLGSTHPPVLLMVEGSDA
ISATACQWRESVHVHLGSALLLCEAGGPKCQHHHMPQAVGPLGWLHAEPTCWTVVKGSLR
QEITFLGGGEVEQGASGGEEGSSGPHIASELRGAVWMEGMTLLGGWSLSCPGPQQLTWLQ
GSRQASLRLLRGQLDVALGPPLAVGSWMWLWAPLTQWAARDGSGQCCSPCPQLWGMEPAC
LCKLTRRSHRCPHSLNLLWIQTCWKGLASPPASEMLAPHPAARLARLGTVQSPESAGNSC
FCVPRLTGSEPLTILPLTLEPEAAAAKAHYKACDRLKLERKQRRMCRRDPGVAETLVEAI
SMSALECQYQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRM
ERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKV
IKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEATGEAGD
ISPPRGRAPGAGGSDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRKCHREKNCESICCGR
GHNTQSRAVTRPCQCQVRWCCYVECKQCTQREEVYTCKG
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggcttctgagacgccagccttccaccctaggttctcggctaccgacgccggggagcag
ctggtggcagaggtggctgtttgggtggctggggccagtcggcaggagggaagactgtcg
gggcggatgctggggtctacccaccccccagtgctactcatggtggaaggctcagatgcc
atcagtgccaccgcctgccagtggagggagtctgtgcatgtgcacctgggctctgccctg
ctcctgtgtgaagccggggggcccaagtgccagcaccaccacatgccacaggctgtaggt
cccctaggctggctgcatgctgagcctacctgctggacagttgtgaagggcagcctcagg
caggagatcacctttctgggagggggagaggtggagcagggtgcctcaggaggggaggag
ggtagcagtggaccccacatagcttcagagctcagaggggctgtgtggatggagggcatg
accctcctgggtggctggagcctgtcctgtccaggcccccagcagctcacttggctgcag
ggcagcaggcaggccagcctgcggctgcttcgtgggcagctggatgtggctctgggcccc
cctctcgcagtgggcagctggatgtggctctgggcccccctcacccagtgggcagcccgg
gatggctctggacagtgctgttctccttgcccacagctgtggggcatggagcctgcctgc
ctctgtaagctgacccgcaggagtcacagatgtccacacagcctgaacctgctgtggata
cagacctgctggaagggccttgcctctcccccagcctccgagatgctggcccctcaccca
gctgctcggctcgcccgcctggggacagtgcagtctcctgagagtgctggtaactcttgc
ttctgtgtgcccaggctgacgggcagtgagcccctgaccatcctccctctgaccctggag
cctgaggccgcggccgccaaggcacactacaaggcctgtgaccggctgaagctggagcgg
aagcagcggcgcatgtgccgccgggacccaggggtggccgagacgctggtggaggccatc
agcatgagcgcccttgagtgccagtaccagttccgtttcgaaagatggaactgcaccctg
gagggccgctaccgggcgagcctgctcaagcgaggcttcaaggagacagccttcctgtac
gccatctcctcggccgggctgacccacgcgctggccaaggcctgcagcgccggccgcatg
gagcgctgcacctgtgacgaggcgcctgacctggagaaccgtgaggcctggcagtggggc
ggctgtggggacaacctcaagtacagcagcaagttcgtcaaggaattcctgggccgcagg
tcgagcaaggacctgcgggcccgcgtggacttccacaacaacctcgtaggcgtgaaggtg
atcaaggccggggtggagaccacgtgcaagtgccatggtgtgtctggctcctgcacagtt
cggacctgctggcgccagctggcacccttccacgaggtgggcaagcacctgaagcacaag
tatgagactgcgctcaaggtgggcagcaccaccaacgaggccacaggcgaggcaggtgac
atctcgccacctcgaggtcgagcaccgggggcgggtggcagcgacccactgcctcgcacc
cccgagctggtgcatctggacgactcgcccagcttctgtctggctggccgcttctccccg
ggcaccgccggccgtaagtgccaccgtgagaagaactgtgagagcatctgctgcgggcgt
ggccacaacacgcagagccgggccgtcacacggccctgccagtgccaggtgcgctggtgc
tgctacgtggagtgcaagcagtgcacgcagcgcgaggaggtctacacctgcaagggctga

KEGG   Loxodonta africana (African savanna elephant): 100662337
Entry
100662337         CDS       T04351                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100662337 (WNT3A)
   04390 Hippo signaling pathway
    100662337 (WNT3A)
   04150 mTOR signaling pathway
    100662337 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100662337 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100662337 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662337 (WNT3A)
   05206 MicroRNAs in cancer
    100662337 (WNT3A)
   05205 Proteoglycans in cancer
    100662337 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100662337 (WNT3A)
   05226 Gastric cancer
    100662337 (WNT3A)
   05217 Basal cell carcinoma
    100662337 (WNT3A)
   05224 Breast cancer
    100662337 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100662337 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    100662337 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100662337 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100662337 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100662337 (WNT3A)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100662337 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100662337
NCBI-ProteinID: XP_023396129
LinkDB
Position
Unknown
AA seq 236 aa
MATGGEGTWHGVQDERVYVIQGAKALRGGTCGDRGGKMRSLAIGHQYSSLGTQPILCASI
PGLVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQFRGRRWNCTTVNNSLAIFGPVLDKA
TRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSGRHQGSPGEGWKWGGCSEDIEFGGMV
SREFADARENRPDARSAMNRHNNEAGRQVCPGEMHPEQGCAGYPGGCGLVWRKASG
NT seq 711 nt   +upstreamnt  +downstreamnt
atggccacagggggtgagggcacctggcatggtgttcaggatgagagggtgtacgtgatc
caaggagcaaaggcccttcggggcgggacttgtggagacagaggtgggaaaatgaggtcc
ctggccatcgggcaccagtactcctctctgggcactcagcccatcctctgtgccagcatc
cccggcctagtgcccaagcagctgcgcttctgccggaactacgtggagatcatgcccagt
gtggcagaaggcgtcaagatcggcatccaggagtgccagcaccagttccgtggccgccga
tggaactgcaccaccgtcaacaacagcctggccatctttgggcctgtgttggacaaagcc
accagggagtcggccttcgtccatgccattgcctcggccggcgtggccttcgctgtgacc
cgctcctgcgcagagggttctgctgccatctgcggctgcagtggccgccatcagggctca
ccaggcgaaggctggaagtggggcggctgcagtgaggacatcgagtttggtgggatggtg
tctcgggagttcgcagatgccagggagaaccgacctgatgcccgctcagccatgaaccgc
cacaacaacgaggctgggcgccaggtatgtcctggggaaatgcaccctgagcaggggtgt
gctgggtaccctggggggtgtggcctggtgtggcgcaaagcttctgggtaa

KEGG   Loxodonta africana (African savanna elephant): 100663058
Entry
100663058         CDS       T04351                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100663058 (WNT3)
   04390 Hippo signaling pathway
    100663058 (WNT3)
   04150 mTOR signaling pathway
    100663058 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100663058 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100663058 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663058 (WNT3)
   05206 MicroRNAs in cancer
    100663058 (WNT3)
   05205 Proteoglycans in cancer
    100663058 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100663058 (WNT3)
   05226 Gastric cancer
    100663058 (WNT3)
   05217 Basal cell carcinoma
    100663058 (WNT3)
   05224 Breast cancer
    100663058 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100663058 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    100663058 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100663058 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100663058 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100663058 (WNT3)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100663058 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100663058
NCBI-ProteinID: XP_003414350
UniProt: G3TBT4
LinkDB
Position
Unknown
AA seq 354 aa
MEPHLLGLLGLLLCGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRN
YIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASA
GVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPD
ARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSA
SEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCN
VTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECVRVYDVHTCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcggcctcctgctctgtggcaccagggtcctcgcc
ggctacccaatttggtggtccctggccctgggccagcagtatacatccctgggctcacag
cccctgctctgcggctccatcccaggcctggtccccaagcaactgcgtttctgccggaat
tacatcgagatcatgcccagcgtggccgagggcgtaaagctgggcatccaggagtgccag
caccagttccggggccgccgctggaactgcaccaccatagacgacagcctggccatcttc
gggccagtccttgacaaagccacccgcgagtcggccttcgtgcacgccatcgcctcggcc
ggagtggccttcgctgtcactcgctcctgcgccgagggcacgtcaaccatctgcggctgc
gattcgcatcataaggggccgcctggcgagggctggaagtggggcggctgcagcgaggac
gctgacttcggggtgctggtgtctcgggagttcgcggacgcgcgcgagaacaggccagac
gcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgaccatcctggaccac
atgcacctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacctgctgg
tgggcccagcccgacttccgggccatcggcgacttcctcaaggacaaatacgacagcgcc
tcggaaatggtggtggagaagcaccgcgagtcccgcggctgggtggagaccctccgggcc
aagtacgcgctcttcaagccgcccactgagagggacctggtctactacgagaactccccc
aacttttgcgagcccaacccggagacgggctcctttggcaccagggaccggacttgcaat
gtcacctcccatggcattgatggctgcgacctgctgtgctgtggccgtggccacaacacg
aggacggagaagcggaaggagaaatgccactgcatcttccattggtgctgctacgtcagc
tgccaggagtgcgtccgcgtctacgacgtgcacacctgcaagtag

KEGG   Loxodonta africana (African savanna elephant): 100664388
Entry
100664388         CDS       T04351                                 

Gene name
WNT4
Definition
(RefSeq) LOW QUALITY PROTEIN: protein Wnt-4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04919  Thyroid hormone signaling pathway
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100664388 (WNT4)
   04390 Hippo signaling pathway
    100664388 (WNT4)
   04150 mTOR signaling pathway
    100664388 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100664388 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100664388 (WNT4)
   04916 Melanogenesis
    100664388 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    100664388 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664388 (WNT4)
   05205 Proteoglycans in cancer
    100664388 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100664388 (WNT4)
   05226 Gastric cancer
    100664388 (WNT4)
   05217 Basal cell carcinoma
    100664388 (WNT4)
   05224 Breast cancer
    100664388 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100664388 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    100664388 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100664388 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100664388 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100664388 (WNT4)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100664388 (WNT4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100664388
NCBI-ProteinID: XP_023410047
LinkDB
Position
Unknown
AA seq 320 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGEGSPKPPVLA
QSGQARAKSEQWRGDGGRYPQLKARTKNWLHAIMISKYQKYYYFKWIWLRDERIDLTLLV
RESTGVMPTQRKHDSRLPICRVSVPTAPSPASTDLFSAPPPQAILSHMRVECKCHGVSGS
CEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRHVGSSRALVPRNAQFKPHTDEDLVYLE
PSPDFVSKDIRSGVLGPRGRTCNKTSKAIEGCELLCCGAASHTAQVELAERCSCKFPTGW
LLSSSAGRCQRLVEVAQRAR
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtgcaagcggaacctggaggtgatggactcagtgcgccgcggcgcccagctcgccatt
gaggagtgccagtaccagttccggaaccggcgctggaactgctccacgcttgactccctg
ccagtctttggcaaggtggtaacgcaaggtgagggaagccccaagcccccagtgctggcc
cagagtggccaggccagggcaaagagtgagcagtggagaggggatggtgggcggtatccc
cagctcaaggcccgaaccaagaactggctacatgctatcatgatatccaaatatcaaaaa
tattactactttaagtggatatggcttcgcgacgagcgcattgatctgacactgctagtc
agagagagcacaggtgtgatgcctacgcagagaaagcatgacagtagacttccaatctgc
agggtaagtgtccccacggctccctctccagcctccactgacctcttctctgcccctccc
ccacaggctatcttgtcacacatgcgggtagagtgcaagtgccatggggtgtcaggctcc
tgtgaggtaaagacgtgttggcgggccgtgccgcccttccgccaggtgggccatgcactg
aaggagaagtttgatggcgccactgaggtggagccacgtcatgtgggctcctccagggca
ctggtgccgcgcaacgcacagttcaagccacatacagatgaggacctggtgtacttggag
cccagcccagacttcgtgagcaaagacatacgcagcggcgtgctgggcccaagaggccgc
acatgcaacaagacatccaaggccatcgaaggctgtgagctgctgtgctgtggggcggct
tcccacacagcccaggtggagctggctgaacgctgcagctgcaaatttcccactgggtgg
ctgctttcgtcaagtgccggcaggtgccagcggctcgtagaagttgcacaacgtgcccga
tga

KEGG   Loxodonta africana (African savanna elephant): 100664544
Entry
100664544         CDS       T04351                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b isoform X2
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100664544 (WNT5B)
   04390 Hippo signaling pathway
    100664544 (WNT5B)
   04150 mTOR signaling pathway
    100664544 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100664544 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100664544 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    100664544 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664544 (WNT5B)
   05205 Proteoglycans in cancer
    100664544 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100664544 (WNT5B)
   05226 Gastric cancer
    100664544 (WNT5B)
   05217 Basal cell carcinoma
    100664544 (WNT5B)
   05224 Breast cancer
    100664544 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100664544 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100664544 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100664544 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100664544 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100664544 (WNT5B)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100664544 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100664544
NCBI-ProteinID: XP_003410665
LinkDB
Position
Unknown
AA seq 384 aa
MQGAPSWKLSVPRVFPGHWRGVRPTMPGLLLLFTAALLSSWAQLLAEANSWWSLAMNPVQ
RPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQYQFRQRRWNCS
TVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRTTRPKDLPRD
WLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADV
ACKCHGVSGSCSLKTCWLQLAEFRKVGDQLKEKYDSAAAMRITRKGKLELVNSRFNQPTP
EDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKIVQVERCH
CRFHWCCFVKCKKCTKIVDQYVCK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgcagggagccccatcttggaagctgtcggtccccagggtcttcccagggcactggaga
ggggtgaggccaacgatgcctggcctgctgctgctcttcacagctgctctgctgtccagc
tgggcgcagcttcttgcagaagccaactcctggtggtcactagctatgaacccggtgcag
agacccgagatgttcatcattggtgcccagcctgtgtgtagccagcttcctggactctcc
cctggccagagaaaactgtgccaattataccaggagcacatggcctacataggggaggga
gccaagacaggcatcaaggagtgccagtaccagtttcggcagaggcggtggaactgcagc
accgtggacaacacttccgtgtttgggagagtcatgcaaataggtagccgagagactgcc
ttcacctatgcagtgagtgctgcgggggtggtcaatgctatcagtcgggcttgccgcgag
ggggagctttctacctgcggctgcagccggacaacgcggcccaaggaccttccccgggac
tggctgtggggtggctgtggggacaatgtggagtacggctaccgctttgctaaggagttt
gtggacgcccgggagcgggagaagaactttgccaagggatcagaggagcaaggacgagtg
ctcatgaacctgcagaacaatgaggcgggccggagggctgtgtataagatggcagatgta
gcctgcaaatgccatggcgtttcagggtcctgcagcctcaagacctgctggctccagctg
gccgagttccgcaaggtgggggaccagctgaaggagaagtatgacagcgccgccgccatg
cgcatcacgcgcaaaggcaagttggagctggtcaacagccgtttcaaccagcccacccca
gaggacctggtgtacgtggatcccagccctgactattgcctgcgcaatgagaccacaggc
tccctgggcacccagggccgcctctgcaacaagacctcggagggcatggatggctgtgag
ctcatgtgctgtggccggggctacgaccagttcaagattgtccaggtggagcgctgccac
tgcagattccactggtgctgctttgtcaagtgcaaaaagtgcaccaagatcgtagaccag
tatgtctgtaaatag

KEGG   Loxodonta africana (African savanna elephant): 100665788
Entry
100665788         CDS       T04351                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100665788 (WNT8B)
   04390 Hippo signaling pathway
    100665788 (WNT8B)
   04150 mTOR signaling pathway
    100665788 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100665788 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100665788 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665788 (WNT8B)
   05205 Proteoglycans in cancer
    100665788 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100665788 (WNT8B)
   05226 Gastric cancer
    100665788 (WNT8B)
   05217 Basal cell carcinoma
    100665788 (WNT8B)
   05224 Breast cancer
    100665788 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100665788 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    100665788 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100665788 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100665788 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100665788 (WNT8B)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100665788 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100665788
NCBI-ProteinID: XP_010587613
LinkDB
Position
Unknown
AA seq 322 aa
MTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVH
AISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDA
LETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLK
EKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEG
RECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVT
KYFCSRADRPRGGTAHKPGRKS
NT seq 969 nt   +upstreamnt  +downstreamnt
atgactggtccaaaggcttacttgatctactccagcagtgtggcagctggtgcccagagt
ggtattgaagaatgcaaataccagtttgcctgggaccgctggaactgccccgagagagcc
ctgcagctgtccagccatggtgggcttcgcagtgctaatcgggagacagcatttgtacat
gccatcagttctgctggggtcatgtacaccctgactagaaactgcagccttggggatttt
gacaactgtggctgtgatgactccagaaatggacaactcggggggcaaggctggctgtgg
ggaggttgtagtgacaacgtaggattcggagaggcaatttccaagcaattcgtcgatgcc
ctggagacaggacaggatgcccgggcagctatgaacctgcacaacaatgaagccggccgc
aaggcagtgaagggcaccatgaaacgcacgtgtaagtgccacggcgtgtccggcagctgc
accacgcagacctgctggctgcagctgcctgagttccgcgaggtgggcgcgcacctgaaa
gagaagtaccacgcagcactcaaggtggacctgctgcagggtgctggcaacagcgcggcc
ggccgcggcgccattgccgacaccttccgctccatctccacccgggagctggtgcacctg
gaggactctccggactactgcctggagaacaaaacgctagggctgctgggcacggaaggc
cgagagtgcctgcggcgcgggagggccctgggccggtgggagcgccgcagctgccgccgc
ctctgcggggactgcgggttggcggtggaggagcgccgcgcggagaccgtgtccagctgc
aattgcaagttccactggtgctgcgctgtacgctgcgagcaatgccgtcggcgggtcacc
aagtacttttgtagccgcgcggaccggccgcgggggggcactgcgcacaagcccgggaga
aaatcctaa

KEGG   Loxodonta africana (African savanna elephant): 100668409
Entry
100668409         CDS       T04351                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100668409 (WNT8A)
   04390 Hippo signaling pathway
    100668409 (WNT8A)
   04150 mTOR signaling pathway
    100668409 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100668409 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100668409 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668409 (WNT8A)
   05205 Proteoglycans in cancer
    100668409 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100668409 (WNT8A)
   05226 Gastric cancer
    100668409 (WNT8A)
   05217 Basal cell carcinoma
    100668409 (WNT8A)
   05224 Breast cancer
    100668409 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100668409 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    100668409 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100668409 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100668409 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100668409 (WNT8A)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100668409 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100668409
NCBI-ProteinID: XP_023405096
LinkDB
Position
Unknown
AA seq 352 aa
MGDLIMLWVAVGICWTTLSASAWSVNNFLITGPKAYLTYTTSVALGAQSGVEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTC
KCHGISGSCSIQTCWLQLADFREMGDYLKAKYDRALKIEMDKPRLRAGNSAEGRWAPTAA
FLPSAEAELIFLEESPDYCIRNSSLGIYGTEGRECLQNSHNTSRWEQRSCGRLCTECGLQ
VEERRTEAISSCNCKFQWCCTVKCDQCRHVVNKYYCMRSPDSARSQDKGSAR
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggggacctgattatgctctgggtggctgtgggcatatgctggaccaccctcagtgct
tctgcctggtcagtgaacaacttcctgataacaggtcccaaggcctatctgacctacacc
accagtgtggccctgggggcccagagtggcgttgaggagtgtaagttccaatttgcttgg
gaacgctggaactgtcctgaaaatgctctgcagctctctactcacaacaggctgagaagt
gccactagggagacttccttcattcacgcaatcagctctgcgggggtcatgtacaccatt
accaagaattgtagcatgggagactttgaaaactgtggctgtgatgagtcaaaaaatgga
aaaacaggaggccacggctggatctggggaggctgcagcgacaatgtggaatttggagaa
agaatctccaagctctttgtggacagcctggagaaggggaaggatgccagagccctgatg
aatcttcataacaatagggcaggaaggctggcagtgagagccaccatgaagaggacctgc
aaatgtcatggcatctcgggaagctgcagcatccagacatgctggctgcagctagctgac
ttccgggagatgggagactacctaaaggccaagtatgaccgggcactgaaaattgagatg
gataagccgcggctaagggctgggaacagtgctgagggccgctgggcacccaccgcggcc
ttccttcctagtgcagaggctgagctgatcttcttggaggagtcaccagattactgtatc
cgcaattccagcctgggcatctatggcacagagggtcgagagtgtctgcagaacagccac
aacacatccaggtgggagcaacgcagctgtgggcgcctgtgcaccgagtgtggtctgcag
gtcgaagagaggagaacagaggccatcagcagctgtaactgcaaattccagtggtgctgc
acagtgaagtgcgaccagtgtaggcacgtagtcaacaagtactattgcatgcgctccccg
gacagcgcccggtcccaagacaagggcagtgcccgatag

KEGG   Loxodonta africana (African savanna elephant): 100674782
Entry
100674782         CDS       T04351                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100674782 (WNT10A)
   04390 Hippo signaling pathway
    100674782 (WNT10A)
   04150 mTOR signaling pathway
    100674782 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100674782 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100674782 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674782 (WNT10A)
   05205 Proteoglycans in cancer
    100674782 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100674782 (WNT10A)
   05226 Gastric cancer
    100674782 (WNT10A)
   05217 Basal cell carcinoma
    100674782 (WNT10A)
   05224 Breast cancer
    100674782 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100674782 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    100674782 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100674782 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100674782 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100674782 (WNT10A)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100674782 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 100674782
NCBI-ProteinID: XP_010600268
UniProt: G3T9L8
LinkDB
Position
Unknown
AA seq 417 aa
MGSAHPRPWLRLRPRPQPRPALCALLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLRACGCDAARRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPPANPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHKDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRATLI
RPHNRNSGQLEPGLAGVPSPAPGAPGPRRRASSADLVYFEKSPDFCEHDPRLDSAGTVGR
LCNKSSTGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccttggctgcggctccgaccccggccccagccgaggccc
gcactctgcgctctcctgttcttcctcctgctgctggctgccgcggtgcccaggtcagca
cccaacgacatcctgggactccgtctgcctccggagcctgtgctcaacgccaacacggtg
tgcctgacattgcctgggctgagcaggcggcagatggaggtgtgtgtgcgccaccctgac
gtggccgcctcagccatccagggcatccagattgccatccatgagtgccagcaccagttc
cgggaccagcgctggaactgctctagccttgagacccgcaacaagatcccctatgagagc
cccatcttcagcagaggtttccgagagagcgccttcgcctacgccattgcggcagccggc
gtggtccacgcggtgtccaacgcgtgcgccctgggcaaactgcgggcatgtggctgcgac
gctgcgcggcgcggggacgaggaggccttccgcaggaagctgcaccgcctgcagctggac
gcactgcagcgcgggaagggcctaagccacggggtcccggagcacccggccctgccccct
gccaaccctggcctgcaggactcctgggaatggggtggctgcagccccgacgtgggcttc
ggggaacgcttctctaaggactttctggactcccgggagccccacaaagacatccatgcc
cgcatgaggctccacaacaacagagtcgggaggcaggcggtgatggagaatatgcgtcgg
aagtgcaagtgccacggcacctcaggcagctgccagctcaagacgtgctggcaggtgacg
ccggagttccgcgcggtgggggcgctgctgcgcagccgcttccaccgcgccacgcttatc
cggccgcacaaccgcaacagcggccagctggagccgggcctcgcgggggtcccctcgccc
gccccgggcgccccgggcccacgccgccgcgccagctccgccgacctggtctacttcgag
aagtcgcctgacttctgcgagcacgacccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcaccggccccgacggctgcggcagcatgtgctgcggccgcggc
cacaatatcctgcgccagacgcgcagcgagcgctgccactgccgcttccactggtgctgc
ttcgtggtctgcgaggagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Loxodonta africana (African savanna elephant): 100675069
Entry
100675069         CDS       T04351                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100675069 (WNT6)
   04390 Hippo signaling pathway
    100675069 (WNT6)
   04150 mTOR signaling pathway
    100675069 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100675069 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100675069 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100675069 (WNT6)
   05205 Proteoglycans in cancer
    100675069 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100675069 (WNT6)
   05226 Gastric cancer
    100675069 (WNT6)
   05217 Basal cell carcinoma
    100675069 (WNT6)
   05224 Breast cancer
    100675069 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100675069 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    100675069 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100675069 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100675069 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100675069 (WNT6)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100675069 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100675069
NCBI-ProteinID: XP_010600270
LinkDB
Position
Unknown
AA seq 331 aa
MDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAF
GRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPLGRPPPRPPGLPGTPRP
PGPAGSPDSSAAWEWGGCGDDVDFGDEKSRLFMDAQYKRGHGDIRALVQLHNNEAGRLAV
RSHTRTECKCHGLSGSCMLRTCWRKLPPFREVGAWLLERFHGASRVMGTNDGKALLPAVR
TLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESV
QLEENCLCRFHWCCVVQCHRCRVSKELSLCL
NT seq 996 nt   +upstreamnt  +downstreamnt
atggaccctaccagcatctgccggaaggctcggcgactggcggggcggcaggccgagttg
tgccaagcggagccggaagtggtagccgaactggcccgaggcgccaggctcggggtgcga
gagtgtcaattccagttccgcttccgccgctggaactgctccagccacagcaaggccttc
gggcgcatcctgcagcaggatatccgggaaacggcctttgtgtttgccatcaccgcggct
ggcgccagtcacgcggtcacgcaggcctgctccatgggtgagctgctgcagtgtggctgc
caggcacccctaggacgccccccgcctcggcctcccggcctgcctggcacccccaggccc
ccaggccccgcgggctcccccgacagcagcgccgcctgggagtggggaggctgcggcgac
gacgtggacttcggagatgagaagtcgaggctctttatggacgcgcagtacaagcgggga
cacggagacatccgtgcgctggtgcaactgcacaacaacgaggctggacggctggcggtg
cggagccacacgcgcactgagtgcaagtgccacggcctgtctggctcatgcatgctgcgc
acctgctggcggaagctacccccgttccgcgaggtgggcgcatggctgcttgagcgcttc
cacggcgcctcgcgcgtcatgggcaccaacgacggtaaggccctgctgcccgccgtgcgc
acgctcaagccgcccggccgcgccgaccttctctacgccgccgactcgcccgacttctgc
gctcccaaccggcgcaccggatcgccaggcacgcgtggccgcgcctgcaacagcagtgcc
ccggacctcagcggctgcgatctgctgtgctgcggccgcgggcaccgccaggagagcgtg
cagctggaggagaactgcctgtgccgcttccactggtgctgcgttgtgcagtgccaccgc
tgccgcgtgagcaaagagctcagcctctgcctctga

KEGG   Loxodonta africana (African savanna elephant): 100675463
Entry
100675463         CDS       T04351                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100675463 (WNT7A)
   04390 Hippo signaling pathway
    100675463 (WNT7A)
   04150 mTOR signaling pathway
    100675463 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100675463 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100675463 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100675463 (WNT7A)
   05205 Proteoglycans in cancer
    100675463 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100675463 (WNT7A)
   05226 Gastric cancer
    100675463 (WNT7A)
   05217 Basal cell carcinoma
    100675463 (WNT7A)
   05224 Breast cancer
    100675463 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100675463 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    100675463 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100675463 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100675463 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100675463 (WNT7A)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Morphogens
   100675463 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 100675463
NCBI-ProteinID: XP_003409782
UniProt: G3SNE4
LinkDB
Position
Unknown
AA seq 349 aa
MNRKARLCLGPPLSQPGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGISFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPHFREMGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRTCNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcgactctgcttgggtccacctctttctcagcctggcatggtctac
ctccggatcggtggcttctcctcagtggtagctctgggcgcgagcatcatctgtaacaag
attcctggcctggctcccagacagcgggcgatctgccagagccggcccgacgccattatc
gtcataggagaaggctcgcaaatgggcctggacgaatgtcagtttcagttccgcaacggc
cgctggaactgctcggcgctgggcgagcgcaccgtcttcggcaaggagctcaaagtggga
agccgggaggctgccttcacgtatgccatcattgctgctggtgtggcccatgccatcaca
gctgcctgtacccagggcaacttgagcgactgtggctgtgacaaggagaagcaaggccag
taccaccgggatgagggctggaagtggggtggctgctctgctgacatccgctacggcatc
agcttcgccaaggtctttgtggatgcacgagagatcaagcagaacgcccggactctcatg
aacttgcacaataacgaggcaggccggaagatcctggaggagaacatgaagctggagtgt
aagtgccatggcgtgtcgggctcgtgcaccaccaagacatgctggaccacgctgccgcac
ttccgggagatgggttacgtgctcaaggacaagtacaacgaggctgtgcacgtggagcca
gtgcgcgccagccgcaacaaacggcccaccttcctgaagatcaagaagcctctctcctac
cgcaagcccatggacacggacctggtgtacatcgagaagtcacccaactactgcgaggag
gacccggtaacgggcagcgtgggcacgcagggccgcacctgcaacaagacagcccctcag
gccagcggctgtgatctcatgtgttgtggccgcggctacaacacccaccagtacgcccgg
gtgtggcagtgcaactgcaaattccactggtgttgctatgtcaagtgcaacacgtgcagc
gagcgcaccgaggtgtacacgtgcaagtga

DBGET integrated database retrieval system