KEGG   Loxodonta africana (African savanna elephant): 100653565
Entry
100653565         CDS       T04351                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04668  TNF signaling pathway
lav04714  Thermogenesis
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04931  Insulin resistance
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04962  Vasopressin-regulated water reabsorption
lav05016  Huntington disease
lav05020  Prion disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05203  Viral carcinogenesis
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100653565 (CREB3L1)
   04024 cAMP signaling pathway
    100653565 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    100653565 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    100653565 (CREB3L1)
   04152 AMPK signaling pathway
    100653565 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100653565 (CREB3L1)
   04922 Glucagon signaling pathway
    100653565 (CREB3L1)
   04915 Estrogen signaling pathway
    100653565 (CREB3L1)
   04926 Relaxin signaling pathway
    100653565 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    100653565 (CREB3L1)
   04918 Thyroid hormone synthesis
    100653565 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    100653565 (CREB3L1)
   04916 Melanogenesis
    100653565 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    100653565 (CREB3L1)
   04927 Cortisol synthesis and secretion
    100653565 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100653565 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100653565 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    100653565 (CREB3L1)
   04728 Dopaminergic synapse
    100653565 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    100653565 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100653565 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100653565 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100653565 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100653565 (CREB3L1)
   05020 Prion disease
    100653565 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    100653565 (CREB3L1)
   05031 Amphetamine addiction
    100653565 (CREB3L1)
   05034 Alcoholism
    100653565 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100653565 (CREB3L1)
   04934 Cushing syndrome
    100653565 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100653565 (CREB3L1)
   05161 Hepatitis B
    100653565 (CREB3L1)
   05163 Human cytomegalovirus infection
    100653565 (CREB3L1)
   05165 Human papillomavirus infection
    100653565 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100653565 (CREB3L1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100653565 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Spc29 Prominin TPR_MLP1_2 APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 100653565
NCBI-ProteinID: XP_003412309
UniProt: G3SVJ0
LinkDB
Position
Unknown
AA seq 520 aa
MDAVLEPFPADRLFPGYSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDMEHGAWALG
HKLCSVMVKQEQSPELPMDPLAASSAMAAAAAMATTPLLGLSPLSSLPVPHQAPGEMTQL
PVIKAEPQEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGCLMPCLPEFSSSSQTVKEDPMATDSVYTASQM
PSRSLLFYDEGAGSWDDGHRALLPVEPPDGWEIKPGGPAEQRPQDHLQHDLLDSTHETTK
YLSETWPEDVGGNGTSPDFSHPKEWFHERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacaggctgttccccggatacagcttcctg
gacttgggggatctaaacgagtctgatttcctcaacaatgcgcactttcctgagcacctg
gaccacttcgcagagaacatggaggacttctccaacgacctgttcagcagcttctttgat
gaccccgtactggatgagaagagccctctcctggacatggaactggactccccgactccg
ggcatccaggccgagcacagctactccctgagcggtgactcagcgcctcagagtcccctt
gtgcccatcaagatggaggacaccacccaagacatggagcatggagcatgggcactggga
cacaaactgtgctccgtcatggtgaagcaggaacagagcccggagctgcccatggaccct
ctggccgcctcctcggctatggctgccgccgccgccatggccaccaccccgctgctgggc
ctcagccccctgtccagtctgcccgtcccccatcaggccccaggagagatgacacagctg
ccagtgatcaaagctgagcctcaggaggtgaaccagttcctcaaagtgacacccgaggac
ctggtgcagatgcctccgacgccccccagcagccacggcagcgacagcgatggctcgcag
agtccccgctctctgccaccctccagccctgttcggcccatggcccgctcctccacagcc
atctccacatctcccctcctcactgccccacacaaattacaggggacatcagggccactg
ctcctgacagaggaggagaagcgcaccttaattgcagagggctaccccatccccacgaaa
ctccccctcaccaaagctgaggagaaggccttgaagagggtccggaggaaaatcaagaac
aagatctcggcccaggagagccgtcgtaagaagaaggaatacgtggaatgtctagaaaag
aaggtggagacatttacatcagagaacaacgaattatggaagaaggtggagaccctggag
aatgccaacaggaccctgctccaacagctgcagaaactccagaccctggtcaccaacaag
atctccagaccttacaagatggctgccacccaaactgggacctgcctcatggtagcagcc
ttgtgctttgttctggtgctgggctgtctcatgccctgccttcctgagttctcctccagc
tcccagactgtgaaggaagaccccatggccactgacagtgtctacacggccagtcagatg
ccctcacgaagcctcctgttctatgatgagggagcaggctcatgggatgatggccacaga
gccctgctgcccgtggagcccccggatggctgggagatcaagcccggggggccagcggag
cagcggccccaggaccatctgcagcatgaccttctggacagcacccacgagaccaccaag
tacctgagtgagacctggccggaggatgtcggcggaaacggcaccagccccgacttctcc
catcccaaggagtggttccatgagagggatctgggccccaacaccaccattaaactctcc
tag

KEGG   Loxodonta africana (African savanna elephant): 100666211
Entry
100666211         CDS       T04351                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04668  TNF signaling pathway
lav04714  Thermogenesis
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04931  Insulin resistance
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04962  Vasopressin-regulated water reabsorption
lav05016  Huntington disease
lav05020  Prion disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05203  Viral carcinogenesis
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100666211 (CREB3L2)
   04024 cAMP signaling pathway
    100666211 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    100666211 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    100666211 (CREB3L2)
   04152 AMPK signaling pathway
    100666211 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100666211 (CREB3L2)
   04922 Glucagon signaling pathway
    100666211 (CREB3L2)
   04915 Estrogen signaling pathway
    100666211 (CREB3L2)
   04926 Relaxin signaling pathway
    100666211 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    100666211 (CREB3L2)
   04918 Thyroid hormone synthesis
    100666211 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    100666211 (CREB3L2)
   04916 Melanogenesis
    100666211 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    100666211 (CREB3L2)
   04927 Cortisol synthesis and secretion
    100666211 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100666211 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100666211 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    100666211 (CREB3L2)
   04728 Dopaminergic synapse
    100666211 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    100666211 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100666211 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100666211 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100666211 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100666211 (CREB3L2)
   05020 Prion disease
    100666211 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    100666211 (CREB3L2)
   05031 Amphetamine addiction
    100666211 (CREB3L2)
   05034 Alcoholism
    100666211 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100666211 (CREB3L2)
   04934 Cushing syndrome
    100666211 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100666211 (CREB3L2)
   05161 Hepatitis B
    100666211 (CREB3L2)
   05163 Human cytomegalovirus infection
    100666211 (CREB3L2)
   05165 Human papillomavirus infection
    100666211 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100666211 (CREB3L2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100666211 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS6_N JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 100666211
NCBI-ProteinID: XP_003420270
UniProt: G3T1W1
LinkDB
Position
Unknown
AA seq 520 aa
MEVLESGEQGTLQWDRKLSELSEPGDGDALLYPTHFSELLDEFSQNVLGQLLNDPFLSEK
SESMEVGPSPTSPAPLIQAEHSYSLCEEPRAQSPFSHTAPGDGFNDDEVESEKWFLSTDF
SSTTIKTEPITDEPPPGLVPSVTLTITAISTPLEKEEPPLEMNAGVDSSCQTVIPTIKLE
PHEVDQFLNFSSKEASVDHLHLPPTPPSSHSSDSEGSLSPNPRLHPFSLPQTPSPARAGV
RAPSSLSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQAL
VMGKVSRTCKLAGTQTSTCLMVVVLCFAVAFGSIFQGSGPYPSATKMALPSQHSVPEPYT
ASVVRSRNLLIYEEHSPLEEPSSAASPGELGAWDRGSSLLRASGLEARPDVDLPQFLLSN
ETSLEKAVLLELQQHLVSSKLEGNETLKVVQLDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagggcaccctgcagtgggaccgcaagctgagtgag
ctgtcggagcccggcgacggcgacgcgctcctgtaccccacgcacttctcagaacttctg
gatgagttctcccagaacgtcttgggccagctcctgaacgaccctttcctctcggagaag
agcgagtcgatggaggtggggccgtccccgacgtcgcctgcgcccctcatccaggctgag
cacagctactccctgtgtgaggagccgcgcgcccagtcgcccttcagccacactgccccc
ggagatggcttcaatgatgatgaagtggaaagtgaaaaatggttcctgtctacagacttt
tcttcaacgaccatcaagacagagccgatcacggatgagccgcctccaggacttgtcccc
tctgtcacgctgaccatcacagccatctccactcctttggaaaaggaggagccccctctg
gaaatgaatgctggggtcgactcctcgtgccagaccgttatccccacgattaagctggag
cctcacgaagtggatcagttcctcaacttctcctctaaagaagcctccgtggaccacctg
cacctaccgccaacccctcccagcagccacagcagcgactcggagggcagcctgagcccc
aacccacgcctgcaccccttcagcctgccgcagactcccagccctgcccgggccggggtg
cgggcaccctcctccctctccagctctcccctcctcaccgccccacataaactgcagggg
tcgggcccactggtcctgacggaggaggagaagaggactctgatcgccgagggctacccc
atccccaccaaattgcccctaaccaagtcagaggagaaggccctgaagaaaatccggagg
aaaatcaagaataagatttctgcccaggagagcaggagaaagaagaaagaatacatggac
agtttggagaaaaaagtggagtcttgttcaactgagaacctggagcttcggaagaaggtg
gaggttctggagaacaccaacagaactctcctccagcagctgcagaagcttcaggccttg
gtcatgggcaaggtttctcggacctgcaagttagccggcacgcagaccagcacctgcctc
atggtcgttgtgctctgctttgctgtggcgtttggcagcattttccagggctctgggccc
tatccctctgccacaaagatggccctgcccagccagcattccgtgccagagccatataca
gcttctgtcgtgagatccagaaacctgcttatctacgaggaacactctcccctggaggaa
ccgtccagcgcagcatcgccgggggagctgggggcctgggacaggggttcctccctgctc
cgggcgtcggggctggaggccaggccggatgtggatcttccccagttcctcctgtcgaat
gagacgagcctggagaaggctgtgcttctggagctgcagcagcacctggtcagctctaaa
ctggaggggaacgaaacactaaaagttgtccagctcgacagaagagtgaacgccaccttt
taa

KEGG   Loxodonta africana (African savanna elephant): 100670574
Entry
100670574         CDS       T04351                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04668  TNF signaling pathway
lav04714  Thermogenesis
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04931  Insulin resistance
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04962  Vasopressin-regulated water reabsorption
lav05016  Huntington disease
lav05020  Prion disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05203  Viral carcinogenesis
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100670574 (CREB3L3)
   04024 cAMP signaling pathway
    100670574 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    100670574 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    100670574 (CREB3L3)
   04152 AMPK signaling pathway
    100670574 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100670574 (CREB3L3)
   04922 Glucagon signaling pathway
    100670574 (CREB3L3)
   04915 Estrogen signaling pathway
    100670574 (CREB3L3)
   04926 Relaxin signaling pathway
    100670574 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    100670574 (CREB3L3)
   04918 Thyroid hormone synthesis
    100670574 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    100670574 (CREB3L3)
   04916 Melanogenesis
    100670574 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    100670574 (CREB3L3)
   04927 Cortisol synthesis and secretion
    100670574 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100670574 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100670574 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    100670574 (CREB3L3)
   04728 Dopaminergic synapse
    100670574 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    100670574 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100670574 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100670574 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100670574 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100670574 (CREB3L3)
   05020 Prion disease
    100670574 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    100670574 (CREB3L3)
   05031 Amphetamine addiction
    100670574 (CREB3L3)
   05034 Alcoholism
    100670574 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100670574 (CREB3L3)
   04934 Cushing syndrome
    100670574 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100670574 (CREB3L3)
   05161 Hepatitis B
    100670574 (CREB3L3)
   05163 Human cytomegalovirus infection
    100670574 (CREB3L3)
   05165 Human papillomavirus infection
    100670574 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100670574 (CREB3L3)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100670574 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136
Other DBs
NCBI-GeneID: 100670574
NCBI-ProteinID: XP_010599585
LinkDB
Position
Unknown
AA seq 297 aa
MNGDLAASGKMASPTCPTGPMDSLELLDLLFDQQDGILRHVELGENWDHPEDQVRLDPDP
SDFITSILGSGDSVPSSPLWSPAASDSGISEDLPSDPQDTPPRNGPPNTPVGCHPTEPGK
GLCPSYHPGYPCPSRPLGPVTPVPEASVAIDLDMWSPQGCLYPEERTELSDSLPRYNLTV
KELLLSGNSGDLQQHHLAAPHLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYE
ERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSAYTAQNQELQRKVLHLEKQNL
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaatggagatttagcagcttctggaaagatggcttcccccacctgtcccacgggtccc
atggacagcctggagctcctggatctccttttcgaccagcaggacggcatcctgagacac
gtagagttgggcgagaactgggaccaccctgaggaccaggtccggctggaccccgacccc
agtgacttcatcacctccatcctgggctctggagactcggtgcccagctccccgctctgg
tcccctgcggccagtgacagtggtatctccgaagacttgccctctgacccccaagacacc
cctccacgaaatggacctcccaacacccctgttggctgccaccccactgagcctggcaag
gggctgtgcccctcctatcatcctggctacccctgcccctccaggcccctggggccagtg
acaccagtgcccgaggcctccgtggccatagacctggacatgtggagcccacaaggatgc
ctctatcctgaggagaggacggagctgtcagactcactcccacgctacaacctcaccgtg
aaggagctcctcctctctggcaatagcggggacctgcaacaacatcatctggcagccccc
cacctgctgcgacctggagctgggcactgccaggagctggtgttgacagaagatgagaag
aagctgcttgccaaagaaggcatcaccctgcccactcagctgcccctcaccaaatatgaa
gagcgagtgctgaaaaaaatccgccggaaaatccggaacaaacagtcggcccaagaaagc
aggaagaaaaagaaggaatatattgatggtctggagactcgaatgtctgcctacaccgcc
cagaaccaggagctgcagaggaaggtcttacatctcgagaagcagaacctgtga

KEGG   Loxodonta africana (African savanna elephant): 100673694
Entry
100673694         CDS       T04351                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04668  TNF signaling pathway
lav04714  Thermogenesis
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04931  Insulin resistance
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04962  Vasopressin-regulated water reabsorption
lav05016  Huntington disease
lav05020  Prion disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05203  Viral carcinogenesis
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100673694 (CREB3L4)
   04024 cAMP signaling pathway
    100673694 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    100673694 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    100673694 (CREB3L4)
   04152 AMPK signaling pathway
    100673694 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100673694 (CREB3L4)
   04922 Glucagon signaling pathway
    100673694 (CREB3L4)
   04915 Estrogen signaling pathway
    100673694 (CREB3L4)
   04926 Relaxin signaling pathway
    100673694 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    100673694 (CREB3L4)
   04918 Thyroid hormone synthesis
    100673694 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    100673694 (CREB3L4)
   04916 Melanogenesis
    100673694 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    100673694 (CREB3L4)
   04927 Cortisol synthesis and secretion
    100673694 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100673694 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100673694 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    100673694 (CREB3L4)
   04728 Dopaminergic synapse
    100673694 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    100673694 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    100673694 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100673694 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100673694 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100673694 (CREB3L4)
   05020 Prion disease
    100673694 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    100673694 (CREB3L4)
   05031 Amphetamine addiction
    100673694 (CREB3L4)
   05034 Alcoholism
    100673694 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100673694 (CREB3L4)
   04934 Cushing syndrome
    100673694 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100673694 (CREB3L4)
   05161 Hepatitis B
    100673694 (CREB3L4)
   05163 Human cytomegalovirus infection
    100673694 (CREB3L4)
   05165 Human papillomavirus infection
    100673694 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100673694 (CREB3L4)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100673694 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 KASH_CCD JMY Spc29 EMP24_GP25L OppC_N DUF2514 Jnk-SapK_ap_N HAUS-augmin3 DUF724 DUF1664 DUF4200 YabA
Other DBs
NCBI-GeneID: 100673694
NCBI-ProteinID: XP_003415140
LinkDB
Position
Unknown
AA seq 392 aa
MSLGNSDLLDVWLEPPEDVFSTGSFQELGLPCPPPEVSVTRQQEQGLQGWTSSGGHGCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPGRPDSPPVPSSPALYEVVYEAGALE
SMQGEAGPAVGLISIQLDQWSPPFMMPDACMVSELPLDAHAHILPRAGTIAPGPPAILLP
SQTLFLTDEEKHLLGQEGVSLPSHLPLTKAEEKVLKKVRRKIRNKQSAQDSRRRKKEYID
GLENRVATCSAQNQELQTKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLF
SLALIILPSLSPFQGLPEAGPEDYQPHGVVSRNILTHKDMPENLETLLVESRLRGPPVAK
GANDSARTWLEKMGGKTGASRLLRSVLHADEM
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgagcctcggaaactctgacttgttggacgtgtggctagaacccccagaagatgtcttc
tcgacaggatccttccaggagctaggactcccctgtccccctccagaggtctcagtgact
aggcaacaagaacaagggctgcaaggctggacgtccagtgggggccatggttgtggtctt
caagagagtgagcctgaagacttcctgaagcttttcattgatcccaatgaggtgtactgc
tcagaagcatctcctggcagtgatagtggcatctcagaggaccctggccgtccagacagt
ccccctgtccccagttcccctgccctctatgaggttgtctatgaggcaggggccctggag
agcatgcagggggaagctggaccagctgtagggctcatttccattcagctagatcagtgg
agccctccatttatgatgcctgatgcctgcatggtcagcgagctgccccttgatgctcat
gcccacatcctgcccagagcaggcaccatagccccagggcctcctgcaatcctgcttcca
agtcaaaccttgtttctgacagatgaagagaagcatctgctggggcaggaaggggtctcc
ctgccctctcacctgcccctcaccaaggcagaggaaaaagtcctgaaaaaggtcagaagg
aaaatccgtaataagcagtcggctcaggacagtcggcggaggaagaaagagtacatcgac
gggctagagaacagggtggctacctgttctgcacagaaccaggaactacagacaaaagtg
caggagctggaaaggcacaacatctccctggtggctcagcttcgccagctccagacactc
attgctcaaacttccaacaaagctgcccagaccagcacctgtgttctgatccttcttttt
tccctggctctcattatcctgcccagcctcagcccctttcagggtctaccagaagctggg
cctgaggattaccagcctcatggagtggtttccagaaatatcctgacccacaaggacatg
ccagaaaatctggagaccctattggtagagtccagactgagggggccacctgtggccaag
ggtgcaaatgactcagcaaggacatggcttgagaagatgggaggaaagacaggtgccagc
aggctcctcagatctgtgctgcatgcagatgagatgtga

KEGG   Loxodonta africana (African savanna elephant): 100675162
Entry
100675162         CDS       T04351                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04380  Osteoclast differentiation
lav04612  Antigen processing and presentation
lav04668  TNF signaling pathway
lav04710  Circadian rhythm
lav04713  Circadian entrainment
lav04714  Thermogenesis
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04931  Insulin resistance
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04962  Vasopressin-regulated water reabsorption
lav05016  Huntington disease
lav05020  Prion disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05203  Viral carcinogenesis
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100675162 (CREB1)
   04024 cAMP signaling pathway
    100675162 (CREB1)
   04022 cGMP-PKG signaling pathway
    100675162 (CREB1)
   04151 PI3K-Akt signaling pathway
    100675162 (CREB1)
   04152 AMPK signaling pathway
    100675162 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100675162 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    100675162 (CREB1)
   04922 Glucagon signaling pathway
    100675162 (CREB1)
   04915 Estrogen signaling pathway
    100675162 (CREB1)
   04926 Relaxin signaling pathway
    100675162 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    100675162 (CREB1)
   04918 Thyroid hormone synthesis
    100675162 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100675162 (CREB1)
   04916 Melanogenesis
    100675162 (CREB1)
   04924 Renin secretion
    100675162 (CREB1)
   04925 Aldosterone synthesis and secretion
    100675162 (CREB1)
   04927 Cortisol synthesis and secretion
    100675162 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100675162 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100675162 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    100675162 (CREB1)
   04728 Dopaminergic synapse
    100675162 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100675162 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    100675162 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100675162 (CREB1)
   04713 Circadian entrainment
    100675162 (CREB1)
   04714 Thermogenesis
    100675162 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100675162 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100675162 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100675162 (CREB1)
   05020 Prion disease
    100675162 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100675162 (CREB1)
   05031 Amphetamine addiction
    100675162 (CREB1)
   05034 Alcoholism
    100675162 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100675162 (CREB1)
   04934 Cushing syndrome
    100675162 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100675162 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100675162 (CREB1)
   05161 Hepatitis B
    100675162 (CREB1)
   05163 Human cytomegalovirus infection
    100675162 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100675162 (CREB1)
   05165 Human papillomavirus infection
    100675162 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100675162 (CREB1)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100675162 (CREB1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100675162 (CREB1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100675162 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 100675162
NCBI-ProteinID: XP_003406152
UniProt: G3TAZ1
LinkDB
Position
Unknown
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccacggtaactttagtacagctgcccaat
ggtcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaggtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttctactattgcagaaagtgaagattcacaggaatcagtggatagcgttactgat
tcccagaaacgaagagagattctttcaaggaggccttcttacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaggaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacagtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggcaccgatggg
gtacagggcctgcagacattaaccatgaccaatgcagccgccactcagccgggtactacc
attctccagtatgcacagaccactgatggacagcagatcctagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtgcaaacatatcagattcgcacagcacccactagc
acgattgcccctggagttgttatggcatcctccccagcacttcctacgcagcctgctgaa
gaagcagcacgaaagagagaggttcgtctgatgaagaacagggaagcagcacgagagtgt
cgtaggaagaagaaggagtatgtgaaatgtttagaaaacagagtggcagtgctggaaaac
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattga

KEGG   Loxodonta africana (African savanna elephant): 100677344
Entry
100677344         CDS       T04351                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04668  TNF signaling pathway
lav04714  Thermogenesis
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04931  Insulin resistance
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04962  Vasopressin-regulated water reabsorption
lav05016  Huntington disease
lav05020  Prion disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05203  Viral carcinogenesis
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100677344 (CREB3)
   04024 cAMP signaling pathway
    100677344 (CREB3)
   04022 cGMP-PKG signaling pathway
    100677344 (CREB3)
   04151 PI3K-Akt signaling pathway
    100677344 (CREB3)
   04152 AMPK signaling pathway
    100677344 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100677344 (CREB3)
   04922 Glucagon signaling pathway
    100677344 (CREB3)
   04915 Estrogen signaling pathway
    100677344 (CREB3)
   04926 Relaxin signaling pathway
    100677344 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    100677344 (CREB3)
   04918 Thyroid hormone synthesis
    100677344 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100677344 (CREB3)
   04916 Melanogenesis
    100677344 (CREB3)
   04925 Aldosterone synthesis and secretion
    100677344 (CREB3)
   04927 Cortisol synthesis and secretion
    100677344 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100677344 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100677344 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    100677344 (CREB3)
   04728 Dopaminergic synapse
    100677344 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    100677344 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100677344 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100677344 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100677344 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100677344 (CREB3)
   05020 Prion disease
    100677344 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    100677344 (CREB3)
   05031 Amphetamine addiction
    100677344 (CREB3)
   05034 Alcoholism
    100677344 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100677344 (CREB3)
   04934 Cushing syndrome
    100677344 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100677344 (CREB3)
   05161 Hepatitis B
    100677344 (CREB3)
   05163 Human cytomegalovirus infection
    100677344 (CREB3)
   05165 Human papillomavirus infection
    100677344 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100677344 (CREB3)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100677344 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf SBE2
Other DBs
NCBI-GeneID: 100677344
NCBI-ProteinID: XP_023400917
LinkDB
Position
Unknown
AA seq 432 aa
MSQSAMVARCITSVVLEAAETGSGRRVRVRVTAKGKVRRRGTRDQQTTGLCMELALGPND
QDLLGFLLEESGDLGVAPEEALEAPLDWELPLSEVKACLLNHVQVLSDWDVEDFLSSLLS
PPASLKALSSFNPCPVSHDHNYSLPQEHVSVDTDSGSCGKVAQMTPLQVKEAGEQEIEEL
ILTEEEKRLLEKEGLSLPGTLPLTKKEEQALKRVRRKIRNKKSAQESRRKKKVYVGGLES
RILKYTAQNLELQNKVQLLEEENLSLLDQLRKLQAMVIQISNKTSSSSTCVLVLLFSFCL
LLIPAMYSSDIRGSLPAEHGVLSRQLRSLPSEDPHQLELPALQSEVPKDSTNQLLDSSDH
FLQVPGNSCCFLNHVPQDPGAEPPLKRTLSDPVSMHSCLSPILPLQTNLTRKGRWLSTHS
PSSVILQVRYSG
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtcccagagtgccatggtggcgagatgtattacttccgttgtgttggaagcggcagag
actggatctgggaggcgggtccgcgtgagagtgacagctaaaggcaaagtgcggcgaaga
gggacccgagaccaacaaacaactgggctgtgtatggagctggcactgggtcccaacgac
caagacctgctgggttttctgctagaggaaagcggagatttgggggtggcgccggaggag
gccctggaggctccgctggactgggagctgccgctctccgaggtcaaagcctgtttattg
aaccatgtgcaggtactgagtgattgggatgtggaggatttcctgagttccctgctaagt
cccccagcatcgttgaaggctctcagctccttcaatccctgtcctgtcagtcatgatcac
aactactctctcccacaggaacatgtctccgtagatacagacagtgggagctgtgggaag
gtggcccagatgactcccctgcaggtgaaggaggctggagagcaggagattgaggaactg
atactgacagaggaggagaagaggctattggagaaggaggggctttcgctgcctgggaca
cttcctcttactaagaaggaggaacaagccctcaaacgagtacggaggaagattcgaaac
aaaaagtctgctcaagagagtcgtaggaagaagaaggtgtatgtgggaggtttagagagc
aggatcttgaaatacacagcccagaatctggagttacagaacaaggtgcagctcttggag
gaagagaatctgtcccttctggatcagctgaggaaactccaagccatggtgattcagata
tcaaacaaaaccagcagcagcagcacctgtgtcctggtcctactcttctccttctgcctc
ctcctcatacctgcgatgtactcctctgacataagggggagcctgccagctgagcatgga
gtgttgtcccgccagcttcgatccctccccagtgaggaccctcaccaactggagctccct
gccctgcagtcagaggtaccaaaggacagcacaaaccagttgctggacagctcagaccat
ttcctccaggtccctggcaattcttgctgctttttgaaccacgtgcctcaggatcctggt
gcagagcctcccctgaagcggaccctctctgaccccgtctcaatgcactcctgcctaagt
cccatccttcccctgcagaccaatctcacaagaaagggtagatggctctctacccacagc
ccctcgtctgtcatcttgcaggtcagatactcaggctag

DBGET integrated database retrieval system