KEGG   Loxodonta africana (African savanna elephant): 100653628
Entry
100653628         CDS       T04351                                 

Gene name
PARD6G
Definition
(RefSeq) partitioning defective 6 homolog gamma
  KO
K06093  partitioning defective protein 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04144  Endocytosis
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100653628 (PARD6G)
   04390 Hippo signaling pathway
    100653628 (PARD6G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100653628 (PARD6G)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100653628 (PARD6G)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100653628 (PARD6G)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100653628 (PARD6G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100653628 (PARD6G)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     100653628 (PARD6G)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 100653628
NCBI-ProteinID: XP_023399903
LinkDB
Position
Unknown
AA seq 563 aa
MPETSPLPRLSVEAKQNLGWASRGTKEARRPAGRLPGPSGPPGAPPGSRVRPLTHHLAPK
PRVWLQAPPWTGPLRPPAQPSSPAFYPGRSPGPAPSRRPAPGPSVPRNLRVIGGGPRKVG
SRPRSAPTWGPASGEMCVEPGRRVQRKQVRGSSDPAGSPLLSEELASCLHPPCVLRGRSH
WKTNLESCSKGKLSIWDVKAGALQFGAEFRRFSLDRHRPGRFEDFYQLVVHTHRLTSTDV
TIGYADVHGDLLPINNDDNFCKAVSSACPLLRVFVQKREEADGCNFGAGALSRKRRVLAA
LREEGLRRRAPPAIGLPRDFRPVSSIIDVDILPETHRRVRLYRHGCEKPLGFYIRDGTSV
RVTAQGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQATDMMIANS
HNLIITVKPANQRNNVVRSSRTSGSSGQSTDSTASPHSLPPAHVLQNFHPDEMESDEEAD
IVIEGALVPQPAPRTQLAPPGSLTRINGASLAYRLNRDLTLSGSGREGNGSIHRLLSSLK
ADPRHSLALPPGGVEEHGPAVTL
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgccagaaaccagtccccttcccaggctgtctgtggaggccaaacagaaccttggctgg
gcgagccggggcacgaaggaagcgaggcgcccggcgggtcgtcttcccgggccctctggt
ccccctggcgcgccccctggctcccgagttcggcccctaactcaccacctggctcccaaa
ccccgggtctggctccaggcacccccctggactggacccctcaggcccccagcccagccc
tccagtcccgcgttttaccccggccggtccccaggccctgcaccctccagacgccccgcg
cccggcccgagcgtgccccgaaacctgcgggtgatcgggggtgggccgcggaaggtgggc
tcgagacctcgctccgcgcccacctggggcccagcctctggggagatgtgtgtggaaccc
gggaggcgagtccagcgaaaacaagtcagaggatcttccgatccagctgggtctccactg
ctttcagaagagctggcctcctgtctccatcctccatgtgtgctcagagggcgtagccac
tggaagaccaacttagaaagctgctcgaagggaaaacttagcatctgggatgtgaaggcc
ggtgctttgcagtttggggccgaattccggaggttctccctggaccgccacaggccgggc
aggttcgaggacttctaccagctggtggtgcacacccaccggctcaccagcactgacgtg
accatcggctatgcggacgtgcacggagatctgctgcccatcaacaatgatgacaacttc
tgcaaggccgtgtccagcgcctgccccctgctccgtgtcttcgtccagaagcgagaggag
gcggacggctgcaacttcggggcaggcgccctgtccagaaagaggcgggtgctggcggcc
ctgcgggaggagggcctgcgccgccgcgcgcccccagccattggcctgccgcgagacttc
cggcctgtctcttccattatcgatgtggacatcctgcccgagacacaccgcagggtgagg
ctgtacaggcacggctgcgagaagccactgggattctacattcgggacggcaccagcgta
cgagtgaccgcccagggcctggagaaggtcccgggtatcttcatctcccgtatggtgccc
ggcggcctggcagagagcactgggctgctggctgtcaacgacgaggtgctcgaggtgaac
ggtatcgaggtggcggggaagacgctggaccaggccacggacatgatgatcgccaacagc
cacaacctcatcatcacggtcaagcccgccaaccagaggaacaacgtggtgcgcagcagc
cgcacatccggcagctccggccagtccacggacagcacagccagccctcacagcctgccg
cccgcgcacgtgctgcagaacttccacccggacgagatggagagtgacgaggaggccgac
atagtcatcgagggcgctctggtgccccagcccgcgccccggacgcagctggcacctccg
ggcagcctcacacgcatcaatggcgccagcctcgcgtaccggctgaacagagacctcact
ctcagtggctcagggcgtgagggcaatggcagcatccacagactgctcagctccctcaaa
gcagatccccgccacagtctagcccttcccccgggaggtgtcgaggagcacgggccagct
gtcaccctctag

KEGG   Loxodonta africana (African savanna elephant): 100654053
Entry
100654053         CDS       T04351                                 

Gene name
PARD6A
Definition
(RefSeq) partitioning defective 6 homolog alpha isoform X1
  KO
K06093  partitioning defective protein 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04144  Endocytosis
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100654053 (PARD6A)
   04390 Hippo signaling pathway
    100654053 (PARD6A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100654053 (PARD6A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100654053 (PARD6A)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100654053 (PARD6A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100654053 (PARD6A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100654053 (PARD6A)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     100654053 (PARD6A)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 100654053
NCBI-ProteinID: XP_003417068
UniProt: G3SZF3
LinkDB
Position
Unknown
AA seq 390 aa
MVRIVGRGERYCQGRGGAARASWPGCVLAPRRAAWGTVPGQPGPAMARPQRTPACSPDSI
VEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDD
SLHRALASGPPPLRLLVQKRAEADSSGLAFGSSSLQRRKKGLLLRPVAPLRTRPSLLISL
PQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFIS
RLVRGGLAERTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQLNNV
VRGASGRLAGLPSAQPGLPEPDDDDNSDLVIENHQPPCSNGLSQGSPCWNLHPSCLPPGA
HSSLPSLDDKEQASSCWGSSIRGDGSGFSL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggtccggatcgtggggcggggcgaacgctactgccaggggcggggcggcgcggcgcgg
gccagctggcccggctgtgtacttgcgcctcggcgggccgcttggggcaccgtccccggc
cagcccggccccgccatggccaggccgcagaggaccccagcgtgcagtccagacagcatc
gtcgaagtgaagagcaaatttgatgccgagttccgacgcttcgcgctgccccgcgcttca
gtgagcggcttccaggagttctcgcggttgctgcgtgccgtgcatcagatcccgggtctg
gacgtgctacttggctatacggatgctcacggcgacctgctgcccctcaccaacgacgac
agcctgcaccgggccctggccagcgggcccccaccgctgcgcctgctggtgcagaagcgg
gcagaagctgactccagtggcttggcctttggctccagctccctgcagcgacgcaagaaa
gggctcctgctgcggccggtagcaccccttcgtactcggccatccctgctcatcagcctg
ccccaagatttccgccaggtttcctctgtcatagacgtggacctactgcctgagacccac
cggcgggtgaggctgcacaagcatggttcagatcgccctctaggcttctacatccgagat
ggcatgagtgtgcgcgtggctccccagggcttggagcgggttccaggcatctttatctca
cgcctagtacgcgggggcctggctgagcgtacagggctgctggcagtcagtgatgagatt
ctcgaggtcaatggcattgaagtggctggaaagaccttggatcaggtgacggacatgatg
gttgccaacagccacaacctcattgtcactgtcaagccagccaaccagctcaataacgtg
gtacggggggcatccgggcgtctggcagggcttccttctgctcagcctgggcttcctgag
cccgacgatgatgacaacagtgacctggtcattgagaaccatcagcctccctgttccaat
gggttgtcccagggatccccatgctggaacctgcaccccagctgtttacctcccggtgct
cacagctctctgccctccctggacgataaggagcaggccagctcttgctgggggagtagc
attcgaggagatggtagtggcttcagcctctga

KEGG   Loxodonta africana (African savanna elephant): 100661665
Entry
100661665         CDS       T04351                                 

Gene name
PARD6B
Definition
(RefSeq) partitioning defective 6 homolog beta
  KO
K06093  partitioning defective protein 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04144  Endocytosis
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100661665 (PARD6B)
   04390 Hippo signaling pathway
    100661665 (PARD6B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100661665 (PARD6B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100661665 (PARD6B)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100661665 (PARD6B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100661665 (PARD6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100661665 (PARD6B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     100661665 (PARD6B)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 100661665
NCBI-ProteinID: XP_003419942
UniProt: G3STP6
LinkDB
Position
Unknown
AA seq 371 aa
MNRSHRHGAGSGYLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLTKKKNVLTNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLHGYTQPTESSFQFDEDSDEDDIIIEDN
GAPQQIPKAVPAAESLESLAQIELSFESGQNGFIPSNEVNLAPGPSGTNTESETRAPDHK
LLEEDGTIITL
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaaccgcagccaccggcacggggcgggcagcggctacctgggcaccatggaggtgaag
agcaagtttggagctgaatttcgtcgtttttcactggaaagatcaaaacctggaaaattt
gaggagttctatggattactgcaacatgttcataagatacccaatgttgacgttttagta
ggctatgcagacatccatggggacttactacctataaataacgatgataattaccacaaa
gctgtttcaacagccaacccactgcttaggatttttattcaaaagaaggaagaagcagac
tacagtgcctttggtacagacacgctaacaaagaagaagaatgtcttaactaatgtattg
cgtcctgacaaccatagaaaaaagccacatatagtcattagtatgccccaagacttcaga
cccgtgtcttccattatagatgtggatattctcccagaaacacatcgtagggtgcgtctt
tacaaatacggcacagagaaacccctagggttctatatccgggatggctccagtgtccgg
gtgacaccacatggcttagagaaggtcccagggatcttcatatccaggcttgtcccagga
ggcctggctcaaagcacaggactcttagctgttaacgatgaagttctagaagttaatggc
atagaagtttcagggaagagtcttgatcaagtaacagacatgatgattgcaaacagccgc
aacctcattataacagtgagaccagcgaaccagaggaataatgttgttaggaacagtcgg
acttccggcagctctggccagtctactgataacagtctccatggctacacacagccgact
gaatcaagctttcagtttgacgaagacagtgatgaagatgacataattattgaagataac
ggagcaccgcagcagatccctaaagctgtgccagctgccgagagcctggagtcgttggca
caaatagaactcagtttcgagtctggacagaatggttttattccttctaacgaagtgaat
ttagcacccggaccaagtggcacgaacacagaatctgaaacacgtgctccagatcacaaa
cttttagaagaagatggaacaatcataacattatga

DBGET integrated database retrieval system