KEGG   Loxodonta africana (African savanna elephant): 100653643
Entry
100653643         CDS       T04351                                 

Gene name
CAMP
Definition
(RefSeq) cathelicidin antimicrobial peptide
  KO
K13916  cathelicidin antimicrobial peptide
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04621  NOD-like receptor signaling pathway
lav04970  Salivary secretion
lav05150  Staphylococcus aureus infection
lav05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100653643 (CAMP)
  09154 Digestive system
   04970 Salivary secretion
    100653643 (CAMP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100653643 (CAMP)
   05152 Tuberculosis
    100653643 (CAMP)
SSDB
Motif
Pfam: Cathelicidins Spp-24 CAP18_C Cystatin
Other DBs
NCBI-GeneID: 100653643
NCBI-ProteinID: XP_003409939
LinkDB
Position
Unknown
AA seq 176 aa
METQRGSTSLQWWSLLLLLGLVVPPAAAKAFSYQEAVLRAVDGLNQQSSDANLYRLLKLN
QQPSGDENPNTPKPVNFTVKETVCPRRTKLPAEQCDFKKNGLVKHCVGTVTLDQTTGFFD
INCDRPRHVRRIRGLRKFFRKSKEKLKKVGRKVKGFFRDVLRRVPYLPGPRFSYAF
NT seq 531 nt   +upstreamnt  +downstreamnt
atggagacccagaggggcagcacttccctgcagtggtggtcactgttgctgctgctgggc
ttggtggtacctccggctgctgccaaggccttcagttaccaagaggccgtgctccgtgct
gtggatggcctcaaccagcagtcctcagatgccaatctctaccgtctcctgaagctgaac
cagcagcccagtggagatgagaacccaaacaccccaaagcctgtgaattttacagtgaag
gagactgtgtgccctaggaggacaaaactgcctgcagagcaatgcgacttcaagaagaat
gggctggtgaagcattgtgtggggaccgtcaccctggaccagaccactggcttctttgac
atcaactgtgataggcccaggcatgtcaggagaattcgcggcttacgtaaattcttccgg
aaaagtaaagagaagctcaagaaagttggccggaaagtcaagggattttttcgggatgtt
ttacgccgggtaccatatctgcctggccctcgcttttcttacgcgttctga

KEGG   Loxodonta africana (African savanna elephant): 104845913
Entry
104845913         CDS       T04351                                 

Definition
(RefSeq) cathelicidin-related peptide Pt_CRAMP1-like
  KO
K13916  cathelicidin antimicrobial peptide
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04621  NOD-like receptor signaling pathway
lav04970  Salivary secretion
lav05150  Staphylococcus aureus infection
lav05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104845913
  09154 Digestive system
   04970 Salivary secretion
    104845913
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    104845913
   05152 Tuberculosis
    104845913
SSDB
Motif
Pfam: Cathelicidins Cystatin
Other DBs
NCBI-GeneID: 104845913
NCBI-ProteinID: XP_010588435
LinkDB
Position
Unknown
AA seq 197 aa
MDGIRVPVLLLQLLLVLTWVEPTSLTEDFSLSQAEALEFTINNYNNQSDEEYAFCVLETQ
PQPDWDPTLSEPQSLYFTIKETECKMVENLTLEQCPFKDNGQVKNCLAIIETSGEGLSVE
LTCEPQNPAEVRKTPGDLEEGGEGQRGRGFRNQNFRLGGFRKRAVAAYVEMQAVTKLKSP
GSQLAHRQLEQNLGRGS
NT seq 594 nt   +upstreamnt  +downstreamnt
atggatggcatcagagtgcccgtgctgctgctccagctgctcctggttctgacttgggtg
gagcctacctccttgactgaggacttcagcctaagccaagccgaggcgctggaattcacc
atcaacaactacaataaccagtcagatgaggagtatgctttctgtgtcctggaaactcag
ccccagccagactgggacccaactctgtcggaaccacagtcactgtattttaccatcaaa
gagacggagtgcaagatggtggagaacctcacccttgagcagtgtcctttcaaggacaat
gggcaagtgaagaactgcttggcaatcatcgagaccagtggggagggtctcagtgtggag
ctcacctgtgaaccccaaaaccctgcagaggtgagaaaaactcctggggatcttgaagaa
ggaggggaagggcagaggggcagagggttcaggaaccagaacttcaggctgggaggtttc
agaaaaagggctgtggcagcatatgtggaaatgcaggctgtcaccaagttaaaaagtcca
ggttctcagctggctcaccggcaactggagcagaatttggggagaggctcttga

DBGET integrated database retrieval system