KEGG   Loxodonta africana (African savanna elephant): 100653674
Entry
100653674         CDS       T04351                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04390  Hippo signaling pathway
lav05160  Hepatitis C
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100653674 (YWHAG)
   04151 PI3K-Akt signaling pathway
    100653674 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100653674 (YWHAG)
   04114 Oocyte meiosis
    100653674 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100653674 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100653674 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100653674 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    100653674 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100653674 (YWHAG)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100653674 (YWHAG)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100653674 (YWHAG)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100653674 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 100653674
NCBI-ProteinID: XP_003416632
UniProt: G3T9F1
LinkDB
Position
Unknown
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtccaatgaa
gaaagaaacctcctctctgtggcttacaagaatgtagttggggcacgccgttcttcctgg
agggtcattagtagcattgagcagaagacatctgcagatggtaatgagaagaagatagag
atggttcgtgcttaccgtgaaaaaatagagaaggagttggaagcggtgtgtcaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagtgagacccagtatgagagtaaa
gtgttttacctgaagatgaaaggggactattatcgctacctggcggaagtagccacagga
gagaaaagggcgactgtcgtggagtcatctgagaaggcctatagtgaagcccatgaaatc
agcaaggagcacatgcagcctactcaccccattagattaggcctggctcttaattactcc
gttttctactatgagatccagaatgcccccgagcaagcttgccacttggccaagacggca
tttgatgacgccattgctgagctcgacactctgaacgaggactcctacaaggactccact
ctcatcatgcagctcctccgtgacaacctcacgctctggacaagcgatcagcaagacgac
gatggtggagaaggcaacaattaa

KEGG   Loxodonta africana (African savanna elephant): 100658856
Entry
100658856         CDS       T04351                                 

Gene name
YWHAB
Definition
(RefSeq) LOW QUALITY PROTEIN: 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04390  Hippo signaling pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100658856 (YWHAB)
   04151 PI3K-Akt signaling pathway
    100658856 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100658856 (YWHAB)
   04114 Oocyte meiosis
    100658856 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100658856 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100658856 (YWHAB)
   05160 Hepatitis C
    100658856 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    100658856 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100658856 (YWHAB)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100658856 (YWHAB)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100658856 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98 DUF4518
Other DBs
NCBI-GeneID: 100658856
NCBI-ProteinID: XP_010590012
LinkDB
Position
Unknown
AA seq 244 aa
MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWR
VISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLK
MKGDYFRYLSEVASGDNKQTTVSNSQQAYQGSIXNXQKEMQPTHPXRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEADAG
EGEN
NT seq 735 nt   +upstreamnt  +downstreamnt
atggataagagtgagctggtacagaaagccaaactcgccgagcaggctgaacgctatgat
gatatggctgcagccatgaaggcagtcacggaacaggggcacgaactctccaacgaagag
agaaatctgctctctgttgcctataagaatgtggtaggtgcccgccgctcttcctggcgt
gtcatctccagcattgaacagaaaacggagaggaatgagaagaagcagcagatgggcaaa
gaataccgtgagaagatagaggcagagctgcaggacatctgcaatgatgttctggagctg
ttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctacttgaaa
atgaaaggagattattttagatacctttctgaggtggcatctggagacaataaacaaacc
actgtgtcgaactcccagcaggcttaccagggaagcatttgaaattagcagaaagaaatg
cagcctacacacccanatcgacttggcctggcgttaaatttctcagtcttttactatgag
attctaaattctcctgaaaaggcctgcagcctggcaaaaacggcatttgatgaagcgatc
gctgaactggatacactgaacgaagagtcttacaaagacagtaccctgatcatgcagcta
cttagggacaatctgactctgtggacgtcggaaaaccagggagatgaagcagacgctggg
gagggagagaactaa

KEGG   Loxodonta africana (African savanna elephant): 100658987
Entry
100658987         CDS       T04351                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon isoform X1
  KO
K06630  14-3-3 protein epsilon
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04390  Hippo signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04722  Neurotrophin signaling pathway
lav05160  Hepatitis C
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100658987 (YWHAE)
   04151 PI3K-Akt signaling pathway
    100658987 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100658987 (YWHAE)
   04114 Oocyte meiosis
    100658987 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100658987 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100658987 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100658987 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100658987 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    100658987 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100658987 (YWHAE)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100658987 (YWHAE)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100658987 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 100658987
NCBI-ProteinID: XP_003416855
UniProt: G3SX83
LinkDB
Position
Unknown
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggctgagcaggctgagcgatac
gacgaaatggtggagtcaatgaagaaggtggcagggatggatgtggagttgacagttgaa
gaaagaaacctcctctcagttgcgtataaaaatgtgattggcgctagaagagcctcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaaactaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcatcccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggcgactaccacaggtatctggctgaatttgctacagggaatgac
aggaaggaggctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaactcccaccaacgcatcccattcgtttaggacttgctctcaacttttccgtattt
tactatgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatactctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgatggcgaa
gagcagaataaagaagcgctgcaggatgtggaagatgagaatcagtga

KEGG   Loxodonta africana (African savanna elephant): 100664090
Entry
100664090         CDS       T04351                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04390  Hippo signaling pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100664090 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    100664090 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100664090 (YWHAQ)
   04114 Oocyte meiosis
    100664090 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100664090 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100664090 (YWHAQ)
   05160 Hepatitis C
    100664090 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    100664090 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664090 (YWHAQ)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100664090 (YWHAQ)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100664090 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 100664090
NCBI-ProteinID: XP_003411928
LinkDB
Position
Unknown
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagacggagttgatccagaaggcgaagctggccgagcaggctgagcgctacgac
gacatggccacctgcatgaaggcggtgacggagcagggggccgagctgtccaacgaggag
cgcaacctgctctcggtggcctacaagaacgtcgtcgggggccgcaggtccgcctggagg
gtcatctcgagcatcgagcagaaaaccgacacctccgacaagaagttgcagctgattaag
gactatcgggagaaagtggagtctgaactgagatccatctgcaccaccgtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtaccttgctgaagtagcatgcggtgatgatcgaaaacaa
acgatagataattcccaaggagcttaccaagaggcatttgatataagcaagaaggagatg
caacccacacatccaatccgcctggggctggctctcaacttttctgtattttactatgag
atccttaataacccagagcttgcctgtacactggctaagacggcttttgatgaggccatt
gcagaactggatacactgaatgaagactcatacaaagacagcacccttatcatgcagttg
cttagagacaacctaacattgtggacatcagacagtgcaggagaagaatgcgatgcagca
gaaggggcagaaaattaa

KEGG   Loxodonta africana (African savanna elephant): 100672224
Entry
100672224         CDS       T04351                                 

Gene name
YWHAZ
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04390  Hippo signaling pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100672224 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    100672224 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100672224 (YWHAZ)
   04114 Oocyte meiosis
    100672224 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100672224 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100672224 (YWHAZ)
   05160 Hepatitis C
    100672224 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    100672224 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100672224 (YWHAZ)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100672224 (YWHAZ)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100672224 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM Peptidase_C98
Other DBs
NCBI-GeneID: 100672224
NCBI-ProteinID: XP_010586735
UniProt: G3SV87
LinkDB
Position
Unknown
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcaaaaggccaaactggccgagcaggctgaacgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctttcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgagcaaaagacagaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagaccgagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaacgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgttacttggctgaggttgctgctggtgatgacaagaaaggg
attgtggatcagtcgcaacaagcataccaagaagcttttgagatcagcaaaaaggaaatg
caaccaacgcatcctatcagattgggtctggcccttaacttctctgtgttctattatgag
attctgaactccccggagaaagcctgctctctcgcaaagacagcttttgatgaagccatc
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcagtta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

KEGG   Loxodonta africana (African savanna elephant): 104846772
Entry
104846772         CDS       T04351                                 

Gene name
YWHAH
Definition
(RefSeq) LOW QUALITY PROTEIN: 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04390  Hippo signaling pathway
lav05160  Hepatitis C
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    104846772 (YWHAH)
   04151 PI3K-Akt signaling pathway
    104846772 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104846772 (YWHAH)
   04114 Oocyte meiosis
    104846772 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104846772 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104846772 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    104846772 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    104846772 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    104846772 (YWHAH)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104846772 (YWHAH)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    104846772 (YWHAH)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   104846772 (YWHAH)
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 104846772
NCBI-ProteinID: XP_010597020
LinkDB
Position
Unknown
AA seq 239 aa
MEGFFPRFSDLALNVYLFGVLQVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIE
QKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMK
GDYYRYLAEVASGERKXSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQ
NAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
NT seq 720 nt   +upstreamnt  +downstreamnt
atggaaggtttctttccaaggttttcagacttggctctcaatgtgtatctttttggggtt
ttgcaggtgacagagctcaatgaacctctttccaatgaagatagaaatctcctctctgtg
gcctacaagaatgtggttggtgccaggcgatcttcctggagggttatcagcagcattgag
cagaagacaatggctgatggaaatgaaaagaaattggagaaggttaaagcttaccgggag
aagattgagaaagagctggagacagtttgcaatgatgtcctggctctgcttgacaagttc
ctcatcaagaactgcaatgatttccagtacgagagcaaggtgttttacctgaaaatgaaa
ggtgattactaccgctacttggcagaggtagcttctggggagagaaaanncagtgtggtc
gaagcttctgaggctgcctataaggaagcttttgaaatcagcaaagagcacatgcaaccg
acgcatcctatccggctgggcctggccctcaacttctccgtgttttactacgagatccag
aatgcgcctgaacaggcgtgcctcctagccaaacaagcctttgatgatgccatagcagag
ctggacacactaaacgaggattcctataaggactccacactcatcatgcagttgctgcga
gacaatctcaccctctggacaagcgaccagcaggatgaagaagcaggagaaggcaactga

DBGET integrated database retrieval system